TB Profiler
This tool processes raw sequence data to infer strain type and identify known drug resistance markers.
A stand alone version of this tool is now available and can now be run on linux or mac. Installation instructions can be found on GitHub and on the bioconda page.



This tool is for Research Use Only. Data and information provided through use of this tool are not intended for medical purpose or objective and should not be used for clinical diagnosis, patient management, or human clinical trials.
Back to results page.
Single nucleotide polymorphisms (SNPs) in coding regions are annotated using the reference amino acid, codon number and alternative amino acid (e.g. Ser315Thr in katG). SNPs in non-coding regions (i.e. RNA genes and intergenic regions) are annotated using the reference nucleotide, gene coordinate and alternative nucleotide (e.g. A1401G in rrs or C-37A in eis promoter). Indels are annotated using the reference VCF allele, gene coordinate and alternative VCF allele (e.g. T902TA insertion in katG).
Name: 5d73a0b7e6a92
Sample: 5d73a0b7e6a92

Download results

Summary
ID: 5d73a0b7e6a92
Date: Sat Sep 7 13:25:06 2019
Strain: lineage4.3;lineage2.2.1;lineage4.1.2;lineage4.1.1
Drug-resistance: Drug-resistant

Drug1ResistanceSupporting Mutations (frequency)
IsoniazidRkatG c.298 299insTG (1.00)
Rifampicin
EthambutolRembB p.His312Arg (1.00), embB p.Leu359Ile (1.00), embB p.Tyr384Asn (1.00), embB p.Ala388Gly (1.00), embB p.Asn399Asp (1.00), embB p.Ala659Thr (1.00)
Pyrazinamide
StreptomycinRrrs r.462c>t (0.99)
Ethionamide
Fluoroquinolones
Amikacin
CapreomycinRtlyA c.513 514del (1.00)
Kanamycin

Lineage2FamilyMain SpoligotypeRDS
lineage4.3Euro-American (LAM)mainly-LAMNone
lineage2.2.1East-Asian (Beijing)Beijing-RD181RD105;RD207;RD181
lineage4.1.2Euro-American (X-type)T;HNone
lineage4.1.1Euro-American (X-type)X1;X2;X3None

Mutations in candidate genes:
GeneChromosome PositionMutationEstimated fraction
gyrB5341c.102T>C1.000
gyrB5347c.108G>C1.000
gyrB5353c.114T>C1.000
gyrB5359c.120C>A1.000
gyrB5363c.124T>C1.000
gyrB5371c.132T>C1.000
gyrB5377c.138T>C1.000
gyrB5396p.Ala53Ser1.000
gyrB5407c.168G>A1.000
gyrB5542c.303A>G1.000
gyrB5545c.306A>G1.000
gyrB5548c.309A>G1.000
gyrB5551c.312T>C1.000
gyrB5614c.375G>C1.000
gyrB5623c.384T>C1.000
gyrB5632c.393A>G1.000
gyrB5638c.399C>T1.000
gyrB5772p.Ala178Asp1.000
gyrB5774p.Val179Ile1.000
gyrB5782c.543A>G1.000
gyrB5788c.549G>C1.000
gyrB5791c.552A>G1.000
gyrB5806c.567C>G1.000
gyrB5809c.570C>G1.000
gyrB5815c.576C>G1.000
gyrB5824c.585A>G1.000
gyrB5827c.588G>A1.000
gyrB5848c.609G>C1.000
gyrB5863c.624G>C1.000
gyrB5873c.634A>C1.000
gyrB5882p.Gln215Asn1.000
gyrB5887p.Asp216Glu1.000
gyrB5902c.663A>G0.982
gyrB5992c.753T>C0.970
gyrB5998c.759T>C0.970
gyrB6001c.762G>C0.970
gyrB6004c.765T>C0.970
gyrB6013c.774G>C0.971
gyrB6022c.783G>C0.972
gyrB6034c.795C>T0.971
gyrB6086p.Thr283Pro1.000
gyrB6091c.852G>C1.000
gyrB6100c.861G>C1.000
gyrB6115c.876A>G1.000
gyrB6123p.Ala295Gly1.000
gyrB6127c.888G>C1.000
gyrB6130c.891T>C1.000
gyrB6133c.894G>C1.000
gyrB6136c.897G>A1.000
gyrB6169c.930C>G1.000
gyrB6190c.951A>G1.000
gyrB6214c.975G>C1.000
gyrB6217c.978G>C0.991
gyrB6223c.984G>C1.000
gyrB6242p.Arg335Lys1.000
gyrB6250c.1011A>G1.000
gyrB6253c.1014G>C1.000
gyrB6274c.1035C>G1.000
gyrB6280c.1041T>C1.000
gyrB6286c.1047T>C1.000
gyrB6292c.1053G>C0.991
gyrB6295c.1056A>G0.991
gyrB6298c.1059C>T0.991
gyrB6299c.1060C>T0.991
gyrB6307c.1068T>G0.992
gyrB6319c.1080G>C0.986
gyrB6325c.1086C>G0.985
gyrB6361c.1122G>A0.982
gyrB6362c.1123T>C0.982
gyrB6379c.1140C>G0.980
gyrB6382c.1143A>G0.980
gyrB6388c.1149T>C0.969
gyrB6400c.1161C>G0.977
gyrB6403c.1164T>C0.976
gyrB6415c.1176G>C0.975
gyrB6427c.1188T>C0.972
gyrB6440p.Thr401Ala0.967
gyrB6448c.1209G>C0.981
gyrB6455p.Val406Ile0.980
gyrB6460c.1221G>C0.980
gyrB6469c.1230T>G0.944
gyrB6472c.1233G>T0.944
gyrB6475c.1236C>A1.000
gyrB6478c.1239G>A0.944
gyrB6484c.1245A>G0.944
gyrB6487c.1248C>G0.944
gyrB6490c.1251T>C0.944
gyrB6496c.1257G>C0.944
gyrB6499c.1260A>G0.944
gyrB6502c.1263T>C0.944
gyrB6508c.1269A>G0.964
gyrB6523c.1284G>C0.966
gyrB6526c.1287T>C0.966
gyrB6535c.1296C>A0.962
gyrB6542p.Ile435Leu0.939
gyrB6547c.1308T>C0.939
gyrB6550c.1311A>G0.939
gyrB6551c.1312T>C0.939
gyrB6565c.1326G>C0.980
gyrB6571c.1332T>C0.980
gyrB6577c.1338T>G0.980
gyrB6580c.1341C>G0.980
gyrB6583c.1344G>C0.980
gyrB6586c.1347T>C0.981
gyrB6598c.1359C>G0.982
gyrB6602c.1363C>T0.983
gyrB6610c.1371C>G0.979
gyrB6613c.1374A>C0.980
gyrB6616c.1377A>G0.980
gyrB6634c.1395T>C1.000
gyrB6637c.1398T>G1.000
gyrB6640c.1401A>G1.000
gyrB6649c.1410T>C1.000
gyrB6652c.1413C>G1.000
gyrB6655c.1416T>C1.000
gyrB6670c.1431G>C1.000
gyrB6673c.1434A>C1.000
gyrB6700c.1461T>C1.000
gyrB6703c.1464G>C1.000
gyrB6706c.1467G>A1.000
gyrB6709c.1470A>G1.000
gyrB6712c.1473G>C1.000
gyrB6730c.1491A>G1.000
gyrB6742c.1503A>G1.000
gyrB6745c.1506T>G1.000
gyrB6760c.1521G>C1.000
gyrB6778c.1539C>T1.000
gyrB6793c.1554T>C1.000
gyrB6797p.Gly520Thr1.000
gyrB6824c.1585C>T1.000
gyrB6841c.1602T>C1.000
gyrB6844c.1605T>G0.990
gyrB6853c.1614A>G1.000
gyrB6856c.1617T>C1.000
gyrB6859c.1620T>C1.000
gyrB6862c.1623C>G1.000
gyrB6878c.1639T>C1.000
gyrB6881c.1642T>C1.000
gyrB6904c.1665C>G1.000
gyrB6910c.1671G>A1.000
gyrB6911p.Asn558His1.000
gyrB6919c.1680T>C1.000
gyrB6925c.1686T>C1.000
gyrB6931c.1692A>C1.000
gyrB6934c.1695A>G1.000
gyrB6937c.1698G>A1.000
gyrB6949c.1710A>G1.000
gyrB6952c.1713C>G1.000
gyrB6955c.1716G>A1.000
gyrB6967c.1728T>C1.000
gyrB6970c.1731C>T1.000
gyrB6973c.1734G>C1.000
gyrB6976c.1737A>G1.000
gyrB6982c.1743A>C1.000
gyrB7000c.1761C>G1.000
gyrB7006c.1767T>G1.000
gyrB7012c.1773G>C1.000
gyrB7018c.1779G>C0.961
gyrB7021c.1782G>C0.960
gyrB7033c.1794G>C1.000
gyrB7051p.Glu604Asp0.985
gyrB7060c.1821T>C1.000
gyrB7066c.1827G>C1.000
gyrB7075c.1836T>G1.000
gyrB7078c.1839A>G1.000
gyrB7081c.1842T>C1.000
gyrB7084c.1845A>G1.000
gyrB7093c.1854T>C1.000
gyrB7099c.1860G>A1.000
gyrB7108c.1869G>A1.000
gyrB7114c.1875C>A1.000
gyrB7124p.Ser629Thr1.000
gyrB7129c.1890T>G1.000
gyrB7132c.1893T>G1.000
gyrB7136c.1897T>C1.000
gyrB7141c.1902T>C1.000
gyrB7144c.1905A>G1.000
gyrB7147c.1908G>C1.000
gyrB7165c.1926C>G0.961
gyrB7178c.1939T>C1.000
gyrB7216c.1977G>C1.000
gyrB7225c.1986T>C1.000
gyrB7237c.1998C>T1.000
gyrA7355c.54T>C1.000
gyrA7362p.Glu21Gln1.000
gyrA7391c.90C>T1.000
gyrA7394c.93T>C1.000
gyrA7427c.126G>C1.000
gyrA7442c.141G>C1.000
gyrA7451c.150C>G1.000
gyrA7457c.156T>C1.000
gyrA7472c.171T>C1.000
gyrA7475c.174A>C1.000
gyrA7480p.Phe60Tyr1.000
gyrA7484c.183T>C1.000
gyrA7487c.186C>G1.000
gyrA7490c.189C>T1.000
gyrA7517c.216G>A1.000
gyrA7523c.222C>G1.000
gyrA7532c.231T>C1.000
gyrA7538c.237G>A1.000
gyrA7541c.240C>G1.000
gyrA7571c.270G>C1.000
gyrA7585p.Ser95Thr1.000
gyrA7595c.294C>G1.000
gyrA7607c.306C>G1.000
gyrA7622c.321C>T1.000
gyrA7626c.325C>T1.000
gyrA7631c.330G>C1.000
gyrA7637c.336C>G1.000
gyrA7646c.345C>T1.000
gyrA7649c.348C>T1.000
gyrA7652c.351C>T1.000
gyrA7658c.357A>G1.000
gyrA7664c.363T>C1.000
gyrA7670c.369A>G1.000
gyrA7676c.375G>C1.000
gyrA7683c.382A>C1.000
gyrA7694c.393A>G1.000
gyrA7697c.396C>G1.000
gyrA7710c.409T>C1.000
gyrA7715c.414G>C1.000
gyrA7728c.427A>C1.000
gyrA7731p.Glu144Gln1.000
gyrA7760c.459C>T1.000
gyrA7763c.462T>C1.000
gyrA7799c.498A>G0.979
gyrA7835c.534A>G0.976
gyrA7838c.537C>G0.974
gyrA7859c.558A>C0.988
gyrA7865c.564T>C0.989
gyrA7883c.582G>C0.984
gyrA7884p.Arg195Gly0.984
gyrA7892c.591G>C0.986
gyrA7898p.Asp199Glu0.960
gyrA7919p.Glu206Asp1.000
gyrA7923p.His208Tyr1.000
gyrA7928p.Asp209Glu1.000
gyrA7942p.Glu214Ala1.000
gyrA7955c.654G>C0.975
gyrA7958c.657C>G0.975
gyrA7963p.Gly221Glu0.973
gyrA7970c.669T>G0.973
gyrA7976c.675C>A0.972
gyrA7979c.678G>C0.972
gyrA7991c.690C>T0.947
gyrA7992p.Ala231Ser0.947
gyrA7997c.696A>C0.950
gyrA8009c.708A>C0.944
gyrA8010p.Ser237Thr0.944
gyrA8020p.Thr240Ile0.920
gyrA8024c.723T>C0.923
gyrA8027c.726T>C0.923
gyrA8036c.735A>G0.968
gyrA8039c.738T>C0.969
gyrA8054c.753T>C0.959
gyrA8057c.756A>G0.961
gyrA8069c.768T>C0.950
gyrA8078c.777A>G0.953
gyrA8090c.789C>G0.936
gyrA8099c.798T>C0.941
gyrA8111c.810G>C0.946
gyrA8156c.855T>C0.952
gyrA8168c.867A>G0.960
gyrA8174c.873C>G0.970
gyrA8177c.876A>C0.970
gyrA8198c.897T>C0.981
gyrA8207c.906T>C0.981
gyrA8219c.918T>C0.972
gyrA8225c.924T>C0.960
gyrA8234c.933T>G0.968
gyrA8235c.934T>C0.989
gyrA8253p.Ile318Leu0.991
gyrA8264c.963T>C0.990
gyrA8267c.966G>C0.990
gyrA8270c.969G>C0.990
gyrA8283p.Ile328Leu0.989
gyrA8288c.987T>C0.988
gyrA8294c.993T>C0.990
gyrA8324c.1023T>C0.973
gyrA8339c.1038A>G0.971
gyrA8342c.1041G>C0.973
gyrA8351c.1050C>T0.973
gyrA8366c.1065G>C0.982
gyrA8375c.1074G>C0.982
gyrA8391p.Tyr364His0.981
gyrA8399c.1098T>C0.981
gyrA8420c.1119T>C0.981
gyrA8423c.1122G>C0.980
gyrA8442c.1141C>T0.947
gyrA8453c.1152A>C0.978
gyrA8462c.1161A>G0.988
gyrA8471c.1170T>C1.000
gyrA8480c.1179C>T1.000
gyrA8486c.1185T>C1.000
gyrA8489c.1188A>G1.000
gyrA8498c.1197C>T1.000
gyrA8504c.1203G>C1.000
gyrA8516c.1215T>C1.000
gyrA8519c.1218A>C1.000
gyrA8537c.1236G>A1.000
gyrA8546c.1245T>C1.000
gyrA8552c.1251C>G1.000
gyrA8556p.Ala419Gln1.000
gyrA8561c.1260A>C1.000
gyrA8562c.1261C>T1.000
gyrA8603c.1302A>G1.000
gyrA8619c.1318T>C1.000
gyrA8624c.1323G>C1.000
gyrA8627c.1326C>G1.000
gyrA8636c.1335A>C1.000
gyrA8642c.1341A>G1.000
gyrA8645c.1344C>G1.000
gyrA8672c.1371A>G1.000
gyrA8693c.1392T>C1.000
gyrA8699c.1398A>G1.000
gyrA8711c.1410A>C1.000
gyrA8714c.1413A>G1.000
gyrA8717c.1416C>G1.000
gyrA8720c.1419G>A1.000
gyrA8726c.1425G>A1.000
gyrA8729c.1428T>C1.000
gyrA8732c.1431G>C1.000
gyrA8735c.1434C>T1.000
gyrA8747c.1446A>G1.000
gyrA8756c.1455A>G1.000
gyrA8762c.1461G>C1.000
gyrA8765p.Asp488Glu1.000
gyrA8767p.Arg489Lys1.000
gyrA8779p.Asp493Ala1.000
gyrA8786c.1485T>C1.000
gyrA8796p.Ile499Val1.000
gyrA8801c.1500G>C1.000
gyrA8810c.1509A>C1.000
gyrA8829c.1528T>C1.000
gyrA8852c.1551T>C1.000
gyrA8858c.1557T>C1.000
gyrA8867c.1566A>G1.000
gyrA8870c.1569G>C1.000
gyrA8873c.1572A>C1.000
gyrA8897c.1596T>C1.000
gyrA8903c.1602T>C1.000
gyrA8915c.1614A>G1.000
gyrA8918c.1617C>G0.676
gyrA8939c.1638T>C1.000
gyrA8942c.1641G>C1.000
gyrA8945c.1644G>C1.000
gyrA8946c.1645T>C1.000
gyrA8951c.1650G>A1.000
gyrA8966c.1665C>G1.000
gyrA8967p.Ala556Arg1.000
gyrA8987c.1686C>G1.000
gyrA8990c.1689C>G1.000
gyrA8996c.1695T>C1.000
gyrA8998p.Leu566Trp1.000
gyrA9023c.1722A>C1.000
gyrA9029c.1728T>C1.000
gyrA9032c.1731T>C1.000
gyrA9035c.1734G>C0.989
gyrA9050p.Asp583Glu1.000
gyrA9051c.1750T>C1.000
gyrA9062c.1761C>G1.000
gyrA9065c.1764C>T1.000
gyrA9068c.1767G>C1.000
gyrA9071c.1770G>C1.000
gyrA9074c.1773G>C1.000
gyrA9080c.1779G>T1.000
gyrA9099c.1798T>C1.000
gyrA9104c.1803C>G1.000
gyrA9119c.1818A>G1.000
gyrA9122c.1821C>G1.000
gyrA9134c.1833C>G1.000
gyrA9143c.1842T>C1.000
gyrA9147p.Gly616Ser1.000
gyrA9152c.1851C>T1.000
gyrA9153p.Thr618Glu1.000
gyrA9164c.1863G>C1.000
gyrA9182c.1881T>C1.000
gyrA9191c.1890G>C1.000
gyrA9200c.1899A>G1.000
gyrA9204p.Ser635Thr1.000
gyrA9227c.1926C>G1.000
gyrA9230c.1929T>C1.000
gyrA9233c.1932C>T1.000
gyrA9242c.1941A>C1.000
gyrA9252p.Val651Ile1.000
gyrA9275c.1974G>A1.000
gyrA9278c.1977G>C1.000
gyrA9281c.1980C>G1.000
gyrA9284c.1983T>C1.000
gyrA9291c.1990C>T1.000
gyrA9296c.1995T>C1.000
gyrA9304p.Gly668Glu1.000
gyrA9311c.2010C>T1.000
gyrA9323c.2022C>G1.000
gyrA9335c.2034G>C1.000
gyrA9345c.2044A>C1.000
gyrA9374c.2073G>C1.000
gyrA9377c.2076A>G1.000
gyrA9383c.2082T>C1.000
gyrA9386c.2085T>C1.000
gyrA9395c.2094G>C1.000
gyrA9413c.2112G>C1.000
gyrA9419c.2118T>C1.000
gyrA9420p.Ile707Ala1.000
gyrA9429p.Arg710Tyr1.000
gyrA9443c.2142G>C1.000
gyrA9449c.2148C>G1.000
gyrA9452c.2151G>C1.000
gyrA9455c.2154T>C1.000
gyrA9458c.2157A>G1.000
gyrA9467c.2166T>C1.000
gyrA9485c.2184A>C1.000
gyrA9488c.2187G>C1.000
gyrA9491c.2190C>G1.000
gyrA9494c.2193T>C1.000
gyrA9497c.2196G>C1.000
gyrA9500c.2199A>G1.000
gyrA9503c.2202T>C1.000
gyrA9518c.2217A>G1.000
gyrA9521c.2220C>T1.000
gyrA9527c.2226A>G0.970
gyrA9542c.2241T>C0.963
gyrA9545c.2244A>G0.963
gyrA9548c.2247T>C0.963
gyrA9557c.2256G>C0.968
gyrA9560c.2259C>G0.968
gyrA9566c.2265C>T0.976
gyrA9575c.2274G>C0.968
gyrA9578c.2277C>T0.968
gyrA9585c.2284T>C0.968
gyrA9590c.2289T>G0.941
gyrA9593c.2292G>T0.943
gyrA9597c.2296T>C0.974
gyrA9605c.2304C>G0.982
gyrA9611p.Asp770Glu1.000
gyrA9626c.2325T>C1.000
gyrA9629c.2328C>G1.000
gyrA9630p.Val777Ile1.000
gyrA9635c.2334T>C1.000
gyrA9644c.2343T>C1.000
gyrA9647c.2346C>T0.980
gyrA9650c.2349G>C1.000
gyrA9665c.2364A>G1.000
gyrA9666p.Arg789Gly1.000
gyrA9674c.2373T>C1.000
gyrA9677c.2376C>T1.000
gyrA9701c.2400T>C1.000
gyrA9704c.2403T>C1.000
gyrA9708c.2407T>C0.985
gyrA9722c.2421C>T1.000
gyrA9734c.2433A>G1.000
gyrA9738c.2437T>C1.000
gyrA9749c.2448G>C1.000
rpoB759573c.-234T>C0.986
rpoB759606c.-201T>C0.988
rpoB759644c.-163T>A1.000
rpoB759647c.-160T>C1.000
rpoB759657c.-150G>C1.000
rpoB759662c.-145C>T1.000
rpoB759667c.-140C>T1.000
rpoB759670c.-137C>T1.000
rpoB759671c.-136G>T1.000
rpoB759672c.-135G>C1.000
rpoB759683c.-124T>C1.000
rpoB759701c.-106A>T1.000
rpoB759707c.-100C>T1.000
rpoB759725c.-82A>C1.000
rpoB759817p.Ser4Phe1.000
rpoB759884c.78A>G1.000
rpoB759896c.90A>C1.000
rpoB759902c.96G>A1.000
rpoB759905c.99C>T1.000
rpoB759914c.108T>C0.970
rpoB759929c.123A>G1.000
rpoB759932c.126T>C1.000
rpoB759941c.135G>C1.000
rpoB759944c.138A>C1.000
rpoB759947c.141C>G1.000
rpoB759950c.144T>G1.000
rpoB759956c.150C>G1.000
rpoB759961p.Thr52Ile1.000
rpoB759965c.159T>C1.000
rpoB759968c.162G>C1.000
rpoB760059p.Tyr85Asp1.000
rpoB760070c.264T>G1.000
rpoB760088c.282C>G1.000
rpoB760091c.285G>C1.000
rpoB760101c.295T>C1.000
rpoB760106c.300G>T1.000
rpoB760112c.306T>C1.000
rpoB760118c.312T>C1.000
rpoB760121c.315T>C1.000
rpoB760130p.Asp108Glu1.000
rpoB760139c.333A>G1.000
rpoB760142c.336C>G1.000
rpoB760181c.375T>C1.000
rpoB760184c.378A>G1.000
rpoB760196c.390C>G1.000
rpoB760223c.417T>C1.000
rpoB760235c.429T>C1.000
rpoB760253c.447T>C1.000
rpoB760283c.477G>C1.000
rpoB760307c.501T>C1.000
rpoB760328c.522G>C1.000
rpoB760331c.525G>C1.000
rpoB760337c.531C>G1.000
rpoB760340c.534G>C1.000
rpoB760361c.555T>C1.000
rpoB760376p.Asp190Glu1.000
rpoB760406c.600G>C1.000
rpoB760418c.612G>C1.000
rpoB760424c.618C>G0.978
rpoB760430c.624T>C1.000
rpoB760475c.669A>G1.000
rpoB760481c.675G>C1.000
rpoB760484c.678A>G1.000
rpoB760514c.708C>T1.000
rpoB760522p.Ser239Asn1.000
rpoB760532c.726T>C1.000
rpoB760533p.Val243Thr1.000
rpoB760547c.741G>C1.000
rpoB760563p.Arg253Met1.000
rpoB760591p.Val262Ala1.000
rpoB760611c.805T>C1.000
rpoB760634c.828T>C1.000
rpoB760646c.840C>G1.000
rpoB760655c.849A>G1.000
rpoB760661c.855A>C1.000
rpoB760670c.864G>C1.000
rpoB760674c.868T>C1.000
rpoB760679c.873A>G0.986
rpoB760683c.877T>C1.000
rpoB760718c.912C>G1.000
rpoB760721c.915C>G1.000
rpoB760724c.918T>C1.000
rpoB760730c.924T>C1.000
rpoB760751c.945G>C1.000
rpoB760757c.951T>C1.000
rpoB760759p.Val318Ala1.000
rpoB760763c.957C>T1.000
rpoB760769c.963C>G1.000
rpoB760775c.969G>C0.878
rpoB760776c.970T>A0.878
rpoB760793c.987A>G1.000
rpoB760805c.999G>C1.000
rpoB760817c.1011A>G1.000
rpoB760820c.1014T>C1.000
rpoB760826c.1020C>G1.000
rpoB760830c.1024T>C1.000
rpoB760845p.Thr347Pro1.000
rpoB760859c.1053T>C1.000
rpoB760862c.1056G>C1.000
rpoB760869p.Val355Ile0.983
rpoB760886c.1080A>G1.000
rpoB760919c.1113C>G1.000
rpoB760925c.1119T>C1.000
rpoB760928c.1122G>C0.987
rpoB760934c.1128C>T1.000
rpoB760946c.1140A>G1.000
rpoB760970c.1164G>C1.000
rpoB760982c.1176G>C1.000
rpoB760985c.1179G>C1.000
rpoB760991c.1185G>C1.000
rpoB761015c.1209G>C1.000
rpoB761021c.1215G>C1.000
rpoB761027c.1221A>G1.000
rpoB761036c.1230G>C1.000
rpoB761037c.1231T>C1.000
rpoB761051c.1245G>T1.000
rpoB761054c.1248G>C1.000
rpoB761057c.1251G>C1.000
rpoB761060c.1254C>G1.000
rpoB761063c.1257C>G1.000
rpoB761097c.1291A>T1.000
rpoB761102c.1296A>G1.000
rpoB761133c.1327T>C1.000
rpoB761150c.1344A>C0.991
rpoB761165c.1359G>C0.978
rpoB761168c.1362C>G0.977
rpoB761171c.1365C>T1.000
rpoB761180c.1374A>C1.000
rpoB761183c.1377T>G1.000
rpoB761189c.1383T>G1.000
rpoB761222c.1416G>C0.990
rpoB761249c.1443A>G1.000
rpoB761255c.1449T>G1.000
rpoB761261c.1455G>T1.000
rpoB761327c.1521A>G1.000
rpoB761360c.1554T>C1.000
rpoB761362p.Ser519Thr1.000
rpoB761373p.Val523His1.000
rpoB761414c.1608A>G1.000
rpoB761423c.1617T>C1.000
rpoB761439545DGRFVEPRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAEE>545ARAGSPRPGCWSAARRARSSTCPRPRWTTWTCRRARWCRWPPR*1.000
rpoB761728c.1923 1924insTC0.980
rpoC763351c.-19T>C0.900
rpoC763352c.-18T>A0.917
rpoC763402c.33C>G0.991
rpoC763411c.42T>G0.991
rpoC763414c.45T>C0.991
rpoC763441c.72C>G0.983
rpoC763444c.75T>C0.983
rpoC763456c.87A>G0.991
rpoC763468c.99G>C0.991
rpoC763486c.117T>C0.982
rpoC763528c.159G>A0.991
rpoC763546c.177A>G0.983
rpoC763570c.201G>C1.000
rpoC763594c.225C>T1.000
rpoC763633c.264T>C0.991
rpoC763636c.267T>C1.000
rpoC763642c.273G>C1.000
rpoC763658c.289C>T1.000
rpoC763675c.306C>G0.992
rpoC763696c.327T>C0.991
rpoC763702c.333C>G0.991
rpoC763708c.339G>A0.989
rpoC763709c.340C>T0.977
rpoC763714c.345G>C0.989
rpoC763717c.348T>C0.989
rpoC763723c.354G>C1.000
rpoC763732c.363C>G0.991
rpoC763735c.366G>C1.000
rpoC763744c.375G>C1.000
rpoC763765c.396T>C1.000
rpoC763768c.399C>G1.000
rpoC763780c.411C>G1.000
rpoC763783c.414G>C1.000
rpoC763801c.432C>G1.000
rpoC763807c.438T>C1.000
rpoC763819c.450G>C1.000
rpoC763831c.462A>G1.000
rpoC763835p.Ala156Met1.000
rpoC763858c.489A>G1.000
rpoC763872p.Gly168Ala0.986
rpoC763876p.Glu169Asp0.986
rpoC763879c.510A>G0.986
rpoC763885c.516C>G0.984
rpoC763888c.519G>C0.984
rpoC763891c.522G>C0.984
rpoC763894c.525A>G0.984
rpoC763945c.576T>C1.000
rpoC763960c.591T>C1.000
rpoC763967p.Gly200Ser0.974
rpoC763978c.609C>G1.000
rpoC763996c.627T>C1.000
rpoC764005c.636G>C0.985
rpoC764011c.642T>C1.000
rpoC764024c.655T>C1.000
rpoC764040p.Ser224Asn1.000
rpoC764044c.675T>C1.000
rpoC764059c.690G>C1.000
rpoC764083c.714A>G1.000
rpoC764098c.729A>G1.000
rpoC764101c.732C>G1.000
rpoC764110c.741C>T1.000
rpoC764131c.762T>C1.000
rpoC764161c.792G>C1.000
rpoC764188c.819A>G1.000
rpoC764195p.Ser276Gln1.000
rpoC764203c.834G>T1.000
rpoC764206c.837T>C1.000
rpoC764257c.888G>C1.000
rpoC764266c.897T>C1.000
rpoC764269c.900G>C1.000
rpoC764282c.913T>A1.000
rpoC764365c.996C>T1.000
rpoC764380c.1011G>C1.000
rpoC764381c.1012T>A1.000
rpoC764387c.1018T>C1.000
rpoC764405c.1036A>C1.000
rpoC764431c.1062G>C1.000
rpoC764434c.1065A>G1.000
rpoC764446c.1077T>C1.000
rpoC764449c.1080G>C1.000
rpoC764452c.1083T>C1.000
rpoC764458c.1089G>C1.000
rpoC764461c.1092A>G1.000
rpoC764497c.1128A>G1.000
rpoC764503c.1134G>C1.000
rpoC764521c.1152T>C1.000
rpoC764536c.1167G>C0.878
rpoC764539c.1170C>G0.882
rpoC764560c.1191T>C1.000
rpoC764566c.1197C>G1.000
rpoC764573c.1204C>T1.000
rpoC764576c.1207T>A1.000
rpoC764581c.1212T>C1.000
rpoC764626c.1257C>T1.000
rpoC764632c.1263T>C1.000
rpoC764650c.1281G>T1.000
rpoC764695c.1326T>C1.000
rpoC764716c.1347G>C1.000
rpoC764752c.1383G>C1.000
rpoC764764c.1395T>C1.000
rpoC764791c.1422C>G1.000
rpoC764809c.1440C>T1.000
rpoC764812c.1443C>G1.000
rpoC764815c.1446A>G1.000
rpoC764824c.1455T>C1.000
rpoC764830c.1461C>G1.000
rpoC764858c.1489T>C1.000
rpoC764872c.1503A>G1.000
rpoC764878c.1509C>G1.000
rpoC764893c.1524T>C1.000
rpoC764911c.1542A>G1.000
rpoC764923c.1554A>G0.990
rpoC764932c.1563C>A0.979
rpoC764968c.1599T>C0.989
rpoC764995c.1626C>G0.990
rpoC765007c.1638T>G0.989
rpoC765019c.1650A>G0.989
rpoC765034c.1665T>C0.989
rpoC765040c.1671T>C0.987
rpoC765041c.1672T>C0.987
rpoC765047c.1678T>C0.989
rpoC765052c.1683C>G0.989
rpoC765073c.1704G>C0.986
rpoC765076c.1707A>G0.986
rpoC765079c.1710T>G0.986
rpoC765082c.1713G>C0.986
rpoC765085c.1716T>C0.986
rpoC765089c.1720T>C0.986
rpoC765103c.1734G>A0.988
rpoC765287c.1918C>T1.000
rpoC765292c.1923G>T1.000
rpoC765298c.1929G>T1.000
rpoC765300p.Val644Ala1.000
rpoC765319c.1950A>G1.000
rpoC765325c.1956C>T1.000
rpoC765326p.His653Ala1.000
rpoC765330p.Ser654Asn1.000
rpoC765349c.1980T>C1.000
rpoC765352c.1983G>C1.000
rpoC765383p.Met672Leu1.000
rpoC765404p.Leu679Val1.000
rpoC765409c.2040T>C1.000
rpoC765412c.2043T>C1.000
rpoC765421c.2052C>G1.000
rpoC765451c.2082C>G0.942
rpoC765452p.Ala695Ser0.941
rpoC765478c.2109T>C1.000
rpoC765493c.2124G>C1.000
rpoC765499c.2130C>G1.000
rpoC765508c.2139C>G1.000
rpoC765541c.2172C>G1.000
rpoC765553c.2184C>T1.000
rpoC765556c.2187G>C1.000
rpoC765559c.2190G>C1.000
rpoC765573p.Asp735Gly1.000
rpoC765577c.2208G>C1.000
rpoC765578c.2209C>T0.984
rpoC765583c.2214G>T1.000
rpoC765613p.His748Gln1.000
rpoC765625c.2256C>G0.988
rpoC765628c.2259G>C1.000
rpoC765631p.Asp754Glu1.000
rpoC765658c.2289C>T1.000
rpoC765700c.2331T>C1.000
rpoC765734c.2365T>C1.000
rpoC765739c.2370G>C1.000
rpoC765751c.2382C>G0.988
rpoC765753p.Asp795Ala1.000
rpoC765772c.2403C>G1.000
rpoC765784c.2415C>G1.000
rpoC765796c.2427C>T1.000
rpoC765811c.2442T>C1.000
rpoC765814c.2445A>G1.000
rpoC765826c.2457T>C1.000
rpoC765835c.2466C>T0.990
rpoC765883c.2514C>G1.000
rpoC765886c.2517C>G1.000
rpoC765892c.2523T>C1.000
rpoC765928c.2559C>G1.000
rpoC765967c.2598C>T1.000
rpoC765979c.2610C>G1.000
rpoC765982c.2613C>T0.991
rpoC765985c.2616C>T1.000
rpoC765994c.2625A>T1.000
rpoC766009c.2640G>C0.990
rpoC766010c.2641T>A0.990
rpoC766015c.2646G>A1.000
rpoC766021c.2652G>C1.000
rpoC766043p.Gln892Glu1.000
rpoC766054c.2685C>G1.000
rpoC766069c.2700G>A0.989
rpoC766082p.Ala905Gln1.000
rpoC766096c.2727G>C1.000
rpoC766105c.2736C>T1.000
rpoC766129c.2760C>G1.000
rpoC766135c.2766G>A1.000
rpoC766141c.2772C>T1.000
rpoC766142c.2773C>T1.000
rpoC766258c.2889T>C1.000
rpoC766270c.2901G>C1.000
rpoC766273c.2904T>C1.000
rpoC766274p.Ala969Thr1.000
rpoC766279c.2910C>G1.000
rpoC766280p.Ser971Gly1.000
rpoC766299p.Thr977Ile1.000
rpoC766309c.2940G>C1.000
rpoC766312c.2943T>G1.000
rpoC766315c.2946C>G1.000
rpoC766327c.2958C>G1.000
rpoC766345c.2976T>C1.000
rpoC766348c.2979A>G1.000
rpoC766363c.2994G>C1.000
rpoC766381c.3012C>T1.000
rpoC766384c.3015A>G1.000
rpoC766390c.3021C>T1.000
rpoC766408c.3039C>T0.990
rpoC766426c.3057C>T1.000
rpoC766444c.3075C>G1.000
rpoC766447c.3078T>C1.000
rpoC766483c.3114G>C1.000
rpoC766484p.Val1039Ile1.000
rpoC766492c.3123T>C1.000
rpoC766495c.3126C>T1.000
rpoC766528c.3159T>G1.000
rpoC766543c.3174C>T1.000
rpoC766573c.3204T>C1.000
rpoC766583p.Gly1072Ser1.000
rpoC766591c.3222A>G1.000
rpoC766594c.3225G>C1.000
rpoC766597c.3228C>G1.000
rpoC766607p.Ile1080Leu1.000
rpoC766630c.3261G>C1.000
rpoC766645c.3276A>G1.000
rpoC766651c.3282T>C1.000
rpoC766657c.3288A>G1.000
rpoC766672c.3303T>C1.000
rpoC766738c.3369G>T0.984
rpoC766750c.3381C>G1.000
rpoC766765c.3396A>C0.992
rpoC766769c.3400C>T0.992
rpoC766774c.3405T>C0.992
rpoC766801c.3432C>G0.981
rpoC766804c.3435A>G0.982
rpoC766861c.3492G>C0.965
rpoC766864c.3495G>C0.982
rpoC766894c.3525T>C0.979
rpoC766895c.3526T>C0.979
rpoC766900c.3531T>C0.979
rpoC766933c.3564A>G0.989
rpoC766945c.3576A>G1.000
rpoC766963c.3594T>C1.000
rpoC766972c.3603G>C1.000
rpoC766978c.3609C>G1.000
rpoC766996c.3627C>T1.000
rpoC767009c.3640T>A0.986
rpoC767014c.3645G>C1.000
rpoC767033c.3664T>A1.000
rpoC767059c.3690T>G1.000
rpoC767062c.3693C>A1.000
rpoC767074c.3705T>C1.000
rpoC767098c.3729T>C1.000
rpoC767119c.3750A>G1.000
rpoC767134c.3765C>G1.000
rpoC767158c.3789T>G1.000
rpoC767167c.3798C>G1.000
rpoC767180p.Ala1271Gln1.000
rpoC767191c.3822C>G1.000
rpoC767206c.3837C>G0.990
rpoC767209c.3840T>C0.990
rpoC767212c.3843G>C0.990
rpoC767221c.3852C>G0.990
rpoC767230c.3861G>C0.991
rpoC767233c.3864T>C0.991
rpoC767263c.3894T>C0.988
rpoC767264p.Ala1299Gln0.988
rpoC767275c.3906T>C0.988
rpoC767278c.3909T>C0.988
rpoC767281c.3912C>G0.988
rpoC767284c.3915C>G0.988
rpsL781348c.-212C>G1.000
rpsL781353c.-207T>C1.000
rpsL781373c.-187G>C1.000
rpsL781571c.12C>T1.000
rpsL781608p.Ser17Gly1.000
rpsL781631c.72G>C1.000
rpsL781649c.90T>C1.000
rpsL781655c.96T>C1.000
rpsL781682c.123T>C1.000
rpsL781715c.156T>C1.000
rpsL781728c.169T>C1.000
rpsL781736c.177T>C1.000
rpsL781751c.192G>C1.000
rpsL781754c.195G>C0.993
rpsL781760c.201T>C0.994
rpsL781793c.234G>C0.993
rpsL781832c.273T>C0.992
rpsL781841c.282C>G0.993
rpsL781859c.300T>C0.992
rpsL781868c.309T>C0.992
rpsL781871c.312G>C0.992
rpsL781892c.333A>G0.992
rpsL781898c.339A>T0.991
rpsL781916c.357T>C0.992
rpsL781929p.Gly124Ser1.000
rplC800796c.-13A>T1.000
rplC800814c.6A>G1.000
rplC800817c.9A>T1.000
rplC800844c.36T>C1.000
rplC800865c.57A>G1.000
rplC800867p.Ser20Asn1.000
rplC800874c.66A>G1.000
rplC800877c.69A>C1.000
rplC800880c.72A>G1.000
rplC800889c.81C>G1.000
rplC800907c.99C>G1.000
rplC800916c.108A>G1.000
rplC800937c.129A>G1.000
rplC800939p.Arg44Gln1.000
rplC800946c.138T>C1.000
rplC800949c.141T>C1.000
rplC800955c.147C>G1.000
rplC800967c.159C>G1.000
rplC800970c.162T>C1.000
rplC800982c.174C>T1.000
rplC800985c.177A>G1.000
rplC800994c.186C>G1.000
rplC801004p.Leu66Val1.000
rplC801009c.201A>C1.000
rplC801012c.204T>C1.000
rplC801019p.Thr71Ala1.000
rplC801024c.216C>G1.000
rplC801027c.219C>G1.000
rplC801031p.Val75Ile1.000
rplC801039c.231A>G1.000
rplC801045c.237A>G1.000
rplC801047p.Tyr80Phe1.000
rplC801054c.246G>C1.000
rplC801070p.Asp88Asn1.000
rplC801073p.Ser89Pro1.000
rplC801078c.270T>C1.000
rplC801081c.273C>G1.000
rplC801085p.Thr93Ala1.000
rplC801090c.282G>A1.000
rplC801099c.291T>C1.000
rplC801102c.294G>C1.000
rplC801105c.297A>G1.000
rplC801109c.301T>C1.000
rplC801114c.306C>G1.000
rplC801127p.Ala107Thr0.981
rplC801132c.324T>C1.000
rplC801147c.339T>C1.000
rplC801150c.342G>C1.000
rplC801153c.345G>C1.000
rplC801156c.348T>A1.000
rplC801171c.363A>G1.000
rplC801174c.366T>C1.000
rplC801183c.375C>A1.000
rplC801222c.414T>C1.000
rplC801228c.420T>C1.000
rplC801246c.438C>G1.000
rplC801249c.441T>G1.000
rplC801255c.447C>T1.000
rplC801267c.459A>C1.000
rplC801270c.462T>C1.000
rplC801276c.468G>C1.000
rplC801279c.471G>C1.000
rplC801282c.474G>C1.000
rplC801301c.493C>A1.000
rplC801312c.504G>C1.000
rplC801324c.516T>C0.986
rplC801336c.528C>G1.000
rplC801339c.531T>C1.000
rplC801341p.Leu178Gln1.000
rplC801348c.540T>G1.000
rplC801357c.549T>C1.000
rplC801367p.Ala187Thr1.000
rplC801396c.588T>C1.000
rplC801402c.594T>C1.000
rplC801405c.597T>C1.000
rplC801417c.609T>C1.000
rplC801423c.615G>C1.000
rplC801438c.630T>C1.000
rplC801442p.Ile212Val1.000
rplC801461653G>A1.000
embR1416295c.1053A>G1.000
embR1416310c.1038C>G1.000
embR1416316c.1032G>C1.000
embR1416330p.Val340Ile1.000
embR1416335p.Asn338Ser1.000
embR1416340c.1008G>T1.000
embR1416343c.1005C>G1.000
embR1416361c.987G>A1.000
embR1416367c.981G>C1.000
rrs1471923r.78t>c1.000
rrs1471934r.89a>g1.000
rrs1471969r.124t>c1.000
rrs1471970r.125g>a1.000
rrs1472028r.183a>t1.000
rrs1472030r.185g>a1.000
rrs1472031r.186g>a1.000
rrs1472034r.189t>c1.000
rrs1472044r.199g>c1.000
rrs1472053r.208agc>a1.000
rrs1472061r.216a>t1.000
rrs1472075r.230a>g1.000
rrs1472969r.1124a>g1.000
rrs1472970r.1125c>g1.000
rrs1472977r.1132g>c1.000
rrs1472978r.1133t>c1.000
rrs1473104r.1259c>t0.994
rrs1473105r.1260g>a0.994
rrs1473120r.1275c>ct0.934
rrs1473123r.1278a>t0.986
rrs1473145r.1300c>t0.986
rrs1473166r.1321g>a0.986
rrs1473288r.1443c>ctt0.910
rrs1473290r.1445c>t1.000
rrs1473382r.1537t>g1.000
rrl1473399c.-259A>AG0.909
rrl1473401c.-257G>A0.990
rrl1473417c.-241C>T0.986
rrl1473419c.-239T>C0.986
rrl1473420c.-238A>G0.986
rrl1473421c.-237G>A0.986
rrl1473436c.-222T>C0.984
rrl1473437c.-221T>C0.984
rrl1473449c.-209G>A0.900
rrl1473569c.-89A>T0.993
rrl1473571c.-87C>T0.993
rrl1473668r.11c>t0.983
rrl1473756r.99g>a0.974
rrl1473758r.101g>t0.974
rrl1473806r.149c>t0.987
rrl1473813r.156c>t0.987
rrl1473839r.182g>t0.993
rrl1473877r.220g>a0.994
rrl1473898r.241c>t1.000
rrl1473899r.242a>c1.000
rrl1473937r.280c>t1.000
rrl1473944r.287g>a1.000
rrl1473945r.288t>c1.000
rrl1473981r.324g>t0.984
rrl1473981r.324g>gtt0.984
rrl1473995r.338g>t1.000
rrl1474001r.344c>t1.000
rrl1474009r.352a>g1.000
rrl1474012r.355c>t1.000
rrl1474025r.368t>g1.000
rrl1474051r.394t>c1.000
rrl1474054r.397t>c1.000
rrl1474056r.399t>c1.000
rrl1474103r.446a>t0.989
rrl1474104r.447g>a0.989
rrl1474111r.454t>c0.989
rrl1474112r.455t>a0.989
rrl1474140r.483c>t1.000
rrl1474151r.494c>t1.000
rrl1474181r.524c>t1.000
rrl1474249r.592g>t1.000
rrl1474290r.633ttttcctctccggagg>t1.000
rrl1474306r.649a>c1.000
rrl1474308r.651g>t1.000
rrl1474310r.653t>g1.000
rrl1474356r.699t>c1.000
rrl1474362r.705a>g1.000
rrl1474376r.719t>c1.000
rrl1474427r.770a>c0.956
rrl1474429r.772g>c0.956
rrl1474432r.775c>g0.956
rrl1474639r.982g>a1.000
rrl1474794r.1137c>t0.993
rrl1474812r.1155g>a0.993
rrl1474823r.1166c>t1.000
rrl1474831r.1174a>g1.000
rrl1474904r.1247g>a1.000
rrl1474956r.1299c>t1.000
rrl1474959r.1302c>t1.000
rrl1474962r.1305tg>t0.981
rrl1474963r.1306g>ga1.000
rrl1474964r.1307t>tac1.000
rrl1474970r.1313g>a1.000
rrl1474991r.1334t>c1.000
rrl1475006r.1349a>t1.000
rrl1475061r.1404c>t1.000
rrl1475088r.1431a>t1.000
rrl1475199r.1542g>a1.000
rrl1475206r.1549c>t0.973
rrl1475209r.1552g>c1.000
rrl1475213r.1556c>t1.000
rrl1475249r.1592t>c1.000
rrl1475252r.1595c>t1.000
rrl1475266r.1609t>c1.000
rrl1475271r.1614a>c1.000
rrl1475273r.1616t>a0.983
rrl1475275r.1618c>t0.983
rrl1475276r.1619t>c1.000
rrl1475291r.1634a>c1.000
rrl1475313r.1656g>a1.000
rrl1475315r.1658a>t1.000
rrl1475333r.1676t>c1.000
rrl1475355r.1698c>t1.000
rrl1475369r.1712g>c1.000
rrl1475419r.1762c>t1.000
rrl1475483r.1826c>t1.000
rrl1475505r.1848g>a1.000
rrl1475526r.1869c>a1.000
rrl1475599r.1942a>g1.000
rrl1475608r.1951t>c1.000
rrl1475638r.1981c>t1.000
rrl1475642r.1985t>c1.000
rrl1475657r.2000a>g1.000
rrl1475659r.2002g>t1.000
rrl1475763r.2106c>t1.000
rrl1475881r.2224t>c1.000
rrl1475988r.2331a>g1.000
rrl1476025r.2368g>t0.984
rrl1476030r.2373a>g1.000
rrl1476032r.2375c>a1.000
rrl1476033r.2376t>c1.000
rrl1476034r.2377c>a1.000
rrl1476045r.2388g>t1.000
rrl1476047r.2390g>t1.000
rrl1476049r.2392c>t1.000
rrl1476086r.2429g>a1.000
rrl1476089r.2432t>c1.000
rrl1476095r.2438c>g1.000
rrl1476106r.2449a>t1.000
rrl1476115r.2458t>c1.000
rrl1476117r.2460g>c0.991
rrl1476224r.2567a>g1.000
rrl1476281r.2624t>c1.000
rrl1476384r.2727g>a1.000
rrl1476583r.2926g>a1.000
rrl1476584r.2927c>t1.000
rrl1476597r.2940g>a0.991
rrl1476608r.2951c>g1.000
rrl1476628r.2971t>a1.000
rrl1476689r.3032a>t1.000
rrl1476690r.3033c>t1.000
rrl1476693r.3036g>a1.000
rrl1476695r.3038t>a1.000
rrl1476716r.3059a>c1.000
rrl1476723r.3066t>a1.000
rrl1476725r.3068c>t1.000
rrl1476726r.3069a>g1.000
rrl1476732r.3075t>c1.000
rrl1476755r.3098g>a1.000
rrl1476759r.3102t>c1.000
rrl1476770r.3113t>c1.000
rrl1476771r.3114g>a1.000
fabG11673302c.-138T>C1.000
fabG11673303c.-137C>G1.000
fabG11673304c.-136G>A1.000
fabG11673315c.-125A>C1.000
fabG11673317c.-123T>C1.000
fabG11673481c.42A>C1.000
fabG11673487c.48T>C1.000
fabG11673490c.51A>C1.000
fabG11673499c.60T>G1.000
fabG11673517c.78G>C1.000
fabG11673523c.84G>T1.000
fabG11673535c.96A>C1.000
fabG11673547c.108T>C1.000
fabG11673574c.135C>G1.000
fabG11673580c.141T>C1.000
fabG11673589c.150A>G1.000
fabG11673595c.156A>C1.000
fabG11673596p.Lys53Asp1.000
fabG11673607c.168T>C1.000
fabG11673610c.171C>T1.000
fabG11673616c.177A>G1.000
fabG11673619c.180T>C1.000
fabG11673633p.Ser65Asn1.000
fabG11673646c.207T>C1.000
fabG11673658c.219G>A1.000
fabG11673660p.Ala74Glu1.000
fabG11673664c.225A>G1.000
fabG11673667c.228A>G1.000
fabG11673679c.240T>G1.000
fabG11673709c.270C>T1.000
fabG11673710p.Leu91Ile1.000
fabG11673716p.Ala93Lys1.000
fabG11673730c.291C>G1.000
fabG11673733p.Met98Ile1.000
fabG11673748c.309A>G1.000
fabG11673749p.Lys104Arg1.000
fabG11673755p.Glu106Thr1.000
fabG11673758p.Lys107Glu1.000
fabG11673778c.339C>G1.000
fabG11673890p.Ala151Ser1.000
fabG11673901c.462A>G1.000
fabG11673905p.Ser156Ala1.000
fabG11673916c.477A>C1.000
fabG11673917p.Val160Leu1.000
fabG11673922c.483T>C1.000
fabG11673925c.486C>G1.000
fabG11673941p.Ala168Ser1.000
fabG11673949c.510G>A1.000
fabG11673955c.516G>C1.000
fabG11674003c.564C>G1.000
fabG11674006p.Asp189Glu1.000
fabG11674018c.579G>C1.000
fabG11674024c.585T>C1.000
fabG11674033c.594T>C1.000
fabG11674037p.Gln200Ala1.000
fabG11674042c.603G>C1.000
fabG11674049p.Gln204Glu1.000
fabG11674054c.615T>C1.000
fabG11674060c.621A>G1.000
fabG11674063c.624G>C1.000
fabG11674079p.Pro214Ala1.000
fabG11674084c.645C>G0.822
fabG11674098p.Val220Ala0.830
fabG11674114c.675T>C1.000
fabG11674123c.684T>C1.000
fabG11674126c.687G>C1.000
fabG11674129c.690C>T1.000
fabG11674132c.693T>C1.000
fabG11674136p.Ser233Ala1.000
fabG11674141c.702T>C1.000
fabG11674147c.708C>G1.000
fabG11674153c.714G>C1.000
fabG11674165c.726C>T1.000
fabG11674171c.732T>C1.000
inhA1674199c.-3C>G1.000
inhA1674205p.Thr2Ala1.000
inhA1674216c.15G>C1.000
inhA1674231c.30T>C1.000
inhA1674237c.36T>C1.000
inhA1674239p.Ser13Thr1.000
inhA1674243c.42A>G1.000
inhA1674279c.78A>C1.000
inhA1674280p.Arg27Lys1.000
inhA1674285c.84A>G1.000
inhA1674296p.Gln32Arg1.000
inhA1674307c.106C>T1.000
inhA1674315c.114C>G1.000
inhA1674321c.120G>C1.000
inhA1674342c.141T>C1.000
inhA1674352p.Thr51Val1.000
inhA1674368p.Ala56Glu1.000
inhA1674379c.178C>T1.000
inhA1674382p.Leu61Ile1.000
inhA1674387c.186A>G1.000
inhA1674399c.198A>G1.000
inhA1674415p.Ala72Asn1.000
inhA1674419p.Ser73Thr1.000
inhA1674421c.220T>C1.000
inhA1674427p.Gly76Gln1.000
inhA1674440p.Glu80Ala1.000
inhA1674443p.Ala81Glu1.000
inhA1674450c.249G>C1.000
inhA1674452p.Ala84Glu1.000
inhA1674480c.279T>C1.000
inhA1674486c.285T>C1.000
inhA1674489c.288G>C1.000
inhA1674507c.306G>C1.000
inhA1674537c.336C>G1.000
inhA1674542p.Ala114Glu1.000
inhA1674549c.348G>C0.979
inhA1674555c.354G>A0.989
inhA1674561c.360C>T0.988
inhA1674582c.381T>C0.985
inhA1674585c.384T>C0.969
inhA1674589p.Met130Leu0.984
inhA1674624c.423A>C1.000
inhA1674627c.426T>G1.000
inhA1674630c.429C>G1.000
inhA1674636c.435C>G1.000
inhA1674654c.453G>C1.000
inhA1674693c.492C>G1.000
inhA1674703c.502T>C1.000
inhA1674718c.517A>C1.000
inhA1674741c.540C>G1.000
inhA1674742p.Lys181Pro1.000
inhA1674745p.Tyr182His1.000
inhA1674750c.549T>C1.000
inhA1674756c.555T>C1.000
inhA1674771c.570C>G1.000
inhA1674774c.573A>G1.000
inhA1674780c.579T>G1.000
inhA1674786c.585G>C1.000
inhA1674799p.Ser200Ala1.000
inhA1674803p.Ala201Gly1.000
inhA1674816c.615T>C1.000
inhA1674818p.Ala206Val1.000
inhA1674828p.Glu209Asp0.917
inhA1674829p.Glu210Gln0.917
inhA1674834c.633C>G0.917
inhA1674836p.Gly212Ala0.917
inhA1674839p.Ala213Glu1.000
inhA1674848p.Gln216Arg0.971
inhA1674855c.654C>G1.000
inhA1674876c.675C>G1.000
inhA1674879c.678T>C1.000
inhA1674903c.702T>C1.000
inhA1674904p.Ala235Pro1.000
inhA1674909c.708G>C1.000
inhA1674915c.714C>G1.000
inhA1674942c.741T>C1.000
inhA1674957c.756G>C1.000
inhA1674963c.762G>C1.000
inhA1674966c.765T>C1.000
inhA1674967p.Asp256Thr1.000
inhA1674993c.792G>C1.000
inhA1674994p.His265Ser1.000
inhA1675008c.807C>G1.000
rpsA1833489c.-53T>A1.000
rpsA1833512c.-30AC>A1.000
rpsA1833518c.-24C>A1.000
rpsA1833541c.-1T>C1.000
rpsA1833554p.Thr5Ala1.000
rpsA1833568c.27G>C1.000
rpsA1833589c.48A>T1.000
rpsA1833595c.54T>C1.000
rpsA1833619c.78A>C1.000
rpsA1833661c.120A>G1.000
rpsA1833667c.126C>G1.000
rpsA1833724c.183C>G1.000
rpsA1833727c.186G>C1.000
rpsA1833742c.201A>G1.000
rpsA1833745c.204G>C1.000
rpsA1833787c.246C>G0.991
rpsA1833790c.249T>A0.991
rpsA1833793c.252C>T0.974
rpsA1833799c.258C>G0.992
rpsA1833811c.270G>C0.992
rpsA1833838c.297G>C0.992
rpsA1833841c.300C>G0.992
rpsA1833847c.306C>G0.993
rpsA1833856c.315A>G0.986
rpsA1833862c.321G>T0.965
rpsA1833874c.333T>C0.986
rpsA1833928c.387G>C0.993
rpsA1833940c.399C>G0.993
rpsA1833970c.429G>C0.991
rpsA1833979c.438T>C0.991
rpsA1834000c.459G>C0.991
rpsA1834015c.474G>C1.000
rpsA1834021c.480C>T1.000
rpsA1834097c.556T>A1.000
rpsA1834102c.561T>C1.000
rpsA1834150c.609G>C1.000
rpsA1834153c.612T>C1.000
rpsA1834154p.Asn205Gln1.000
rpsA1834157c.616T>C1.000
rpsA1834162c.621A>G1.000
rpsA1834165c.624A>G1.000
rpsA1834169p.Thr210Ala1.000
rpsA1834177c.636A>C1.000
rpsA1834186c.645C>G1.000
rpsA1834189c.648G>C0.992
rpsA1834195c.654G>C1.000
rpsA1834222c.681T>C1.000
rpsA1834225c.684C>G1.000
rpsA1834231c.690T>C1.000
rpsA1834240c.699T>C1.000
rpsA1834249c.708T>C1.000
rpsA1834261c.720A>C1.000
rpsA1834264c.723G>C1.000
rpsA1834297c.756C>G1.000
rpsA1834303c.762T>G1.000
rpsA1834306c.765T>C1.000
rpsA1834348c.807T>C1.000
rpsA1834366c.825A>G1.000
rpsA1834375c.834G>A0.991
rpsA1834396c.855G>C0.978
rpsA1834411c.870T>C0.989
rpsA1834417c.876G>C0.976
rpsA1834423c.882G>C0.988
rpsA1834435c.894G>C0.989
rpsA1834451c.910T>C0.989
rpsA1834465c.924T>C0.988
rpsA1834468c.927A>G0.989
rpsA1834474c.933C>G0.989
rpsA1834489c.948T>C0.989
rpsA1834498c.957C>T0.989
rpsA1834513c.972C>G0.992
rpsA1834528c.987T>G1.000
rpsA1834546c.1005T>C1.000
rpsA1834555c.1014T>C1.000
rpsA1834558c.1017C>G1.000
rpsA1834606c.1065C>G1.000
rpsA1834609c.1068T>C1.000
rpsA1834622c.1081T>A1.000
rpsA1834633c.1092A>G1.000
rpsA1834639c.1098T>C1.000
rpsA1834666c.1125G>C1.000
rpsA1834669c.1128G>C1.000
rpsA1834688c.1147A>T1.000
rpsA1834726c.1185C>A1.000
rpsA1834732c.1191T>C1.000
rpsA1834733p.Ala398Pro1.000
rpsA1834753c.1212T>C1.000
rpsA1834765c.1224A>G1.000
rpsA1834780c.1239A>G1.000
rpsA1834786c.1245A>G1.000
rpsA1834789c.1248T>C1.000
rpsA1834792c.1251G>C1.000
rpsA1834852c.1311C>G1.000
rpsA1834948c.1407G>A1.000
rpsA1834954c.1413G>C1.000
rpsA1834957c.1416C>G1.000
rpsA1834969c.1428A>G1.000
tlyA1917943p.Ala2Ser1.000
tlyA1917951c.12T>C1.000
tlyA1917972c.33A>G1.000
tlyA1917981c.42G>C1.000
tlyA1917990c.51G>C1.000
tlyA1917993c.54A>G1.000
tlyA1917996c.57A>G1.000
tlyA1917999c.60T>C1.000
tlyA1918002c.63A>G1.000
tlyA1918015c.76T>C1.000
tlyA1918036p.Arg33Ser1.000
tlyA1918048p.Leu37Met1.000
tlyA1918191c.252G>C1.000
tlyA1918197c.258T>C1.000
tlyA1918206c.267G>C1.000
tlyA1918212c.273A>G1.000
tlyA1918218c.279C>G1.000
tlyA1918233c.294A>G1.000
tlyA1918236c.297A>G1.000
tlyA1918296c.357G>C1.000
tlyA1918310p.Asn124Ser1.000
tlyA1918315p.Pro126Ala1.000
tlyA1918326c.387G>C1.000
tlyA1918329c.390C>G1.000
tlyA1918330p.Leu131Val1.000
tlyA1918335c.396G>A1.000
tlyA1918346p.Ala136Val1.000
tlyA1918350c.411T>C1.000
tlyA1918352p.Gly138Asp1.000
tlyA1918356c.417C>G1.000
tlyA1918377c.438T>G1.000
tlyA1918379p.Arg147Pro1.000
tlyA1918382p.Val148Ala1.000
tlyA1918392c.453A>G1.000
tlyA1918398c.459C>G1.000
tlyA1918417c.478T>C1.000
tlyA1918420p.Ala161Cys1.000
tlyA1918425c.486C>G1.000
tlyA1918434c.495C>G1.000
tlyA1918442p.Val168Ala1.000
tlyA1918446c.507A>C1.000
katG2155847p.Pro89Asp1.000
pncA2288816c.426C>G1.000
pncA2288820p.Gln141Arg1.000
pncA2288822c.420G>C1.000
pncA2288828c.414A>G1.000
pncA2288834c.408A>G1.000
pncA2288843c.399A>G1.000
pncA2288846c.396A>G1.000
pncA2288855c.387A>G1.000
pncA2288864c.378A>G1.000
pncA2288870c.372G>C1.000
pncA2288897c.345T>C1.000
pncA2288903c.339G>C1.000
pncA2288909p.Glu111Asp1.000
pncA2288918c.324T>G1.000
pncA2288921c.321T>C1.000
pncA2289074c.168G>A0.920
pncA2289194c.48A>G0.947
pncA2289206c.36G>A1.000
pncA2289212c.30C>T1.000
kasA2518121p.Gln3Lys1.000
kasA2518132c.18C>T1.000
kasA2518138c.24T>C1.000
kasA2518146p.Phe11Tyr1.000
kasA2518162c.48G>A1.000
kasA2518174c.60A>G1.000
kasA2518190p.Ser26Ala1.000
kasA2518199p.Ile29Val1.000
kasA2518222c.108G>A1.000
kasA2518223c.109T>C1.000
kasA2518234c.120G>A1.000
kasA2518248p.Ala45Val1.000
kasA2518261p.Glu49Asp1.000
kasA2518263p.Phe50Tyr1.000
kasA2518265p.Val51Ile1.000
kasA2518396c.282A>G1.000
kasA2518403p.Ser97Thr1.000
kasA2518413p.Ser100Asn1.000
kasA2518421p.Val103Leu1.000
kasA2518426c.312T>C1.000
kasA2518429c.315A>C1.000
kasA2518439p.Ala109Ser0.972
kasA2518444c.330T>C1.000
kasA2518447c.333T>G1.000
kasA2518450c.336C>G1.000
kasA2518459c.345T>C1.000
kasA2518462c.348A>C1.000
kasA2518468c.354A>T1.000
kasA2518475c.361A>C1.000
kasA2518480c.366T>C1.000
kasA2518483c.369C>G1.000
kasA2518504c.390T>C1.000
kasA2518506p.Ala131Glu1.000
kasA2518519c.405G>C1.000
kasA2518528c.414C>G1.000
kasA2518540c.426T>G1.000
kasA2518561c.447T>C0.988
kasA2518567c.453G>C0.986
kasA2518570c.456G>C0.986
kasA2518574p.Ile154Val0.986
kasA2518588c.474T>C0.988
kasA2518591c.477G>C0.987
kasA2518609p.Met165Ile0.988
kasA2518621c.507G>A0.986
kasA2518642c.528A>G0.984
kasA2518663c.549T>C0.938
kasA2518672c.558G>C0.938
kasA2518687c.573C>T0.922
kasA2518696c.582C>G0.937
kasA2518702c.588C>T0.934
kasA2518711c.597A>G0.929
kasA2518714c.600A>C0.930
kasA2518732c.618C>G0.931
kasA2518741c.627G>C0.935
kasA2518747c.633C>G0.943
kasA2518768c.654C>G0.938
kasA2518783c.669T>C0.931
kasA2518792c.678C>G0.931
kasA2518795c.681C>G0.919
kasA2518816c.702C>A0.951
kasA2518822c.708C>G0.948
kasA2518825c.711T>C0.936
kasA2518855c.741C>G0.934
kasA2518864c.750G>C0.933
kasA2518879c.765A>G0.936
kasA2518885c.771T>C0.932
kasA2518888c.774C>T0.931
kasA2518898c.784T>C0.919
kasA2518906c.792A>G0.912
kasA2518910p.Leu266Met0.907
kasA2518921c.807T>C0.872
kasA2518927c.813C>G0.806
kasA2518930c.816G>C0.828
kasA2518936c.822C>G0.821
kasA2518939c.825T>C0.821
kasA2518942c.828T>C0.821
kasA2518951c.837G>C0.875
kasA2518954c.840C>G0.875
kasA2518963c.849T>C0.900
kasA2519053c.939G>C0.923
kasA2519062c.948T>G0.932
kasA2519068c.954C>T0.933
kasA2519072p.Ala320Thr0.920
kasA2519077c.963G>C0.915
kasA2519095c.981C>G0.882
kasA2519098c.984C>G0.882
kasA2519104c.990T>A0.878
kasA2519108p.Asp332Gln0.889
kasA2519111p.Gln333Glu0.892
kasA2519116c.1002C>G0.893
kasA2519125c.1011C>T0.911
kasA2519137c.1023T>C0.945
kasA2519146c.1032C>A0.957
kasA2519167c.1053T>C0.954
kasA2519173c.1059C>G0.951
kasA2519176c.1062G>A0.939
kasA2519197c.1083G>C0.963
kasA2519215c.1101C>T0.947
kasA2519221c.1107G>C0.955
kasA2519225c.1111C>T0.955
kasA2519233c.1119C>T0.864
kasA2519236c.1122G>A0.850
kasA2519239c.1125A>C0.875
kasA2519242c.1128C>G0.929
kasA2519245c.1131T>C0.933
kasA2519251c.1137G>A0.933
kasA2519257c.1143C>T0.933
kasA2519260c.1146T>G0.933
kasA2519264p.Val384Ile0.933
kasA2519269c.1155C>G0.933
kasA2519272c.1158C>G0.933
kasA2519281c.1167G>C0.933
kasA2519287c.1173T>C0.933
kasA2519293c.1179T>C0.933
kasA2519298p.Arg395Gln0.933
kasA2519305c.1191A>G0.933
kasA2519306p.Val398Ile0.933
kasA2519323c.1209G>C0.985
kasA2519329c.1215C>T0.984
kasA2519338c.1224T>C0.983
kasA2519344c.1230G>A0.981
kasA2519347c.1233T>G0.981
kasA2519359c.1245T>C0.962
ahpC2726288c.96C>T1.000
ahpC2726303c.111T>C1.000
ahpC2726312c.120T>C1.000
ahpC2726315p.Asp41Glu1.000
ahpC2726318p.Glu42Asp1.000
ahpC2726322p.Pro44Ala1.000
ahpC2726336c.144G>C1.000
ahpC2726348c.156T>C1.000
ahpC2726354c.162G>C1.000
ahpC2726357c.165A>G1.000
ahpC2726366c.174G>C1.000
ahpC2726372c.180G>C1.000
ahpC2726378c.186T>C1.000
ahpC2726390c.198G>C1.000
ahpC2726391p.Ala67Thr1.000
ahpC2726397p.Ser69Gly1.000
ahpC2726408c.216T>C1.000
ahpC2726528c.336C>G1.000
ahpC2726546c.354C>G1.000
ahpC2726551p.Gln120Leu1.000
ahpC2726556p.Ala122Thr1.000
ahpC2726564c.372C>T1.000
ahpC2726570c.378C>T1.000
ahpC2726579c.387T>C1.000
ahpC2726591c.399C>G1.000
ahpC2726593p.Val134Ala1.000
ahpC2726600c.408T>C1.000
ahpC2726612c.420C>G1.000
ahpC2726638p.Ala149Val0.989
ahpC2726645c.453C>G0.989
ahpC2726657c.465A>C0.978
ahpC2726669p.Asp159Glu0.987
ahpC2726672c.480G>A0.986
ahpC2726675c.483A>G0.987
ahpC2726681c.489A>G0.987
ahpC2726687c.495C>G0.987
ahpC2726693c.501C>G0.986
ahpC2726696c.504C>G0.986
ahpC2726717c.525A>G0.984
ahpC2726735c.543C>T0.982
folC2746158c.1441A>G1.000
folC2746162c.1437C>T1.000
folC2746165c.1434A>C1.000
folC2746171c.1428C>G1.000
folC2746174c.1425T>G0.952
folC2746183c.1416A>C1.000
folC2746375c.1224C>G1.000
folC2746416p.Glu395Gln1.000
folC2746420c.1179T>C1.000
folC2746531c.1068C>G1.000
folC2746555c.1044C>A1.000
folC2746561c.1038G>T1.000
folC2746564c.1035T>G1.000
folC2746569p.Ser344Arg1.000
folC2746576c.1023G>T1.000
folC2746584c.1015C>A1.000
folC2746594c.1005A>G1.000
folC2746597c.1002G>T1.000
folC2746609c.990A>G0.955
folC2746612c.987G>A1.000
folC2746618c.981C>A1.000
folC2746621c.978G>A1.000
folC2746631p.Gly323Val1.000
folC2746642c.957A>G1.000
folC2746648c.951C>G1.000
folC2746651c.948A>G1.000
folC2746657c.942A>G1.000
folC2746663c.936A>G1.000
folC2746666c.933G>C1.000
folC2746703p.Ala299Val1.000
folC2746711c.888T>C1.000
folC2746714c.885A>G1.000
folC2746728c.871A>G1.000
folC2746734p.Ile289Val1.000
folC2746741c.858G>A1.000
folC2746744c.855A>C1.000
folC2746753c.846G>C1.000
folC2746756c.843G>C1.000
folC2746765c.834T>C1.000
folC2746936c.663A>G1.000
folC2746948c.651C>G1.000
folC2746963c.636G>A1.000
folC2746974p.Ile209Leu1.000
folC2746980p.Ala207His1.000
folC2746981c.618A>G1.000
folC2746984c.615G>C1.000
folC2746987c.612A>G1.000
folC2746999c.600A>G1.000
folC2747002c.597A>G1.000
folC2747007c.592C>G1.000
folC2747023c.576G>C1.000
folC2747032c.567T>G1.000
folC2747040p.Ile187Val0.987
folC2747059c.540A>G0.988
folC2747065c.534G>C0.965
folC2747086c.513T>G0.981
folC2747089c.510C>G0.980
folC2747098c.501G>C0.979
folC2747101c.498C>G0.978
folC2747107c.492C>G0.966
folC2747110c.489A>G0.965
folC2747113c.486G>C0.953
folC2747116c.483C>G0.942
folC2747149c.450G>A0.950
folC2747221c.378C>T0.927
folC2747224c.375C>G0.927
folC2747234p.Ala122Asp0.950
folC2747236c.363C>G0.950
folC2747243p.Gln119Arg0.951
folC2747245c.354C>G0.953
folC2747264p.Gly112Ala0.986
folC2747275c.324A>G0.986
folC2747281c.318T>C0.986
folC2747289p.Pro104Ala0.984
folC2747290c.309T>G0.984
folC2747293c.306C>T0.986
folC2747302c.297T>C0.987
folC2747314c.285T>G0.986
folC2747317c.282G>C1.000
folC2747355p.Val82Ile1.000
folC2747359c.240G>C1.000
folC2747362c.237C>G1.000
folC2747394p.Ile69Val1.000
folC2747395c.204A>G1.000
folC2747401c.198C>G1.000
folC2747407c.192A>G1.000
folC2747412p.Ser63Ala1.000
folC2747416c.183T>C1.000
folC2747419c.180G>C1.000
folC2747430c.169G>A1.000
folC2747439p.Met54Leu0.984
folC2747442c.157A>G0.984
folC2747443c.156C>T0.984
folC2747464c.135C>G0.944
folC2747467p.Asp44Glu0.925
folC2747475p.Arg42Lys0.941
folC2747491c.108T>C0.944
folC2747497c.102G>C0.919
folC2747500c.99T>C0.921
folC2747503c.96A>G0.921
folC2747506c.93C>T0.921
folC2747509c.90A>G0.921
folC2747523p.Ser26Ala0.943
folC2747524c.75C>G0.917
folC2747539c.60A>G0.914
ribD2987558c.720T>C1.000
ribD2987561c.723C>G1.000
ribD2987564c.726T>C1.000
ribD2987567c.729C>G1.000
ribD2987570c.732C>G1.000
ribD2987580p.Ser248Ala1.000
thyX3067199c.747T>C1.000
thyX3067205c.741C>G1.000
thyX3067210c.736A>G1.000
thyX3067220c.726C>G1.000
thyX3067223c.723C>G1.000
thyX3067244c.702G>C1.000
thyX3067249p.Thr233Ala1.000
thyX3067252p.Val232Ile1.000
thyX3067277c.669G>C1.000
thyX3067280c.666C>G1.000
thyX3067284p.Ala221Asp1.000
thyX3067286c.660G>C1.000
thyX3067289c.657G>C1.000
thyX3067293p.Gln218Arg1.000
thyX3067304c.642T>C1.000
thyX3067316c.630T>C1.000
thyX3067325c.621T>C1.000
thyX3067355c.591T>G1.000
thyX3067367c.579C>G1.000
thyX3067376c.570C>G1.000
thyX3067391c.555C>G1.000
thyX3067394c.552C>G1.000
thyX3067412c.534G>C1.000
thyX3067439c.507T>C1.000
thyX3067445c.501G>C1.000
thyX3067451c.495C>T1.000
thyX3067457c.489G>C1.000
thyX3067465p.Ile161Val1.000
thyX3067466c.480C>G1.000
thyX3067470p.Asn159Ser1.000
thyX3067493c.453T>C1.000
thyX3067500p.Lys149Arg1.000
thyX3067515p.Ser144Thr1.000
thyX3067526c.420G>C0.933
thyX3067531p.Ala139Ser0.931
thyX3067545p.Glu134Ala0.967
thyX3067549p.Thr133Ala0.966
thyX3067556p.His130Gln1.000
thyX3067560p.Arg129Gln0.792
thyX3067565p.Asp127Glu0.792
thyX3067570p.Ala126Pro0.792
thyX3067571c.375G>A0.792
thyX3067577p.Glu123Asp0.800
thyX3067582p.Met122Leu1.000
thyX3067586c.360G>C1.000
thyX3067601c.345C>G1.000
thyX3067604c.342C>G1.000
thyX3067610p.Lys112Asn1.000
thyX3067613c.333C>T0.982
thyX3067619c.327T>G1.000
thyX3067640c.306C>G1.000
thyX3067643c.303G>A1.000
thyX3067652c.294A>G1.000
thyX3067661c.285G>C1.000
thyX3067682c.264C>G1.000
thyX3067685c.261T>C1.000
thyX3067688c.258C>G1.000
thyX3067694c.252C>G1.000
thyX3067718c.228G>C1.000
thyX3067721c.225A>G1.000
thyX3067724c.222C>T0.971
thyX3067727c.219T>G1.000
thyX3067739c.207A>G1.000
thyX3067742c.204T>G1.000
thyX3067762p.Arg62Lys1.000
thyX3067765p.Leu61Ile1.000
thyX3067781c.165G>C1.000
thyX3067787c.159C>T1.000
thyX3067793c.153A>G1.000
thyX3067799c.147C>T1.000
thyX3067802c.144G>C1.000
thyX3067814c.132A>G1.000
thyX3067826c.120G>C1.000
thyX3067850c.96T>G1.000
thyX3067869p.Thr26Ser0.938
thyX3067874c.72G>C0.937
thyX3067883c.63G>C1.000
thyX3067886c.60T>G1.000
thyX3067889c.57G>C1.000
thyX3067894c.52A>G1.000
thyX3067935p.Thr4Ile0.911
thyX3067947c.-2GC>C1.000
thyA3073692c.780T>G1.000
thyA3073695c.777A>G1.000
thyA3073698c.774T>C1.000
thyA3073704c.768C>G1.000
thyA3073710c.762A>G1.000
thyA3073727p.Lys249His1.000
thyA3073731c.741A>C1.000
thyA3073736p.Ile246Val1.000
thyA3073740p.Glu244Asp1.000
thyA3073743c.729A>G1.000
thyA3073752p.Glu240Asp1.000
thyA3073761c.711T>C1.000
thyA3073815c.657C>T1.000
thyA3073824c.648T>G1.000
thyA3073827c.645T>C1.000
thyA3073839c.633A>G1.000
thyA3073863c.609A>G1.000
thyA3073874p.Ile200Val1.000
thyA3073878c.594C>T1.000
thyA3073892c.580A>G1.000
thyA3073893c.579G>T0.992
thyA3073925c.547A>G1.000
thyA3073929c.543A>G1.000
thyA3073953c.519A>G1.000
thyA3073977c.495T>C1.000
thyA3073989c.483A>G1.000
thyA3074001c.471G>C1.000
thyA3074004c.468A>G1.000
thyA3074010c.462G>C1.000
thyA3074031c.441A>G1.000
thyA3074037c.435G>C1.000
thyA3074057p.Glu139Pro1.000
thyA3074061c.411T>C1.000
thyA3074076c.396G>C1.000
thyA3074082c.390C>G1.000
thyA3074097c.375G>C1.000
thyA3074100c.372A>G1.000
thyA3074106c.366A>G1.000
thyA3074117c.355G>A0.989
thyA3074120c.352A>G1.000
thyA3074130c.342C>G1.000
thyA3074157c.315G>C1.000
thyA3074160c.312T>C1.000
thyA3074165p.Ala103Thr1.000
thyA3074172c.300C>G1.000
thyA3074175c.297T>C1.000
thyA3074181c.291T>C1.000
thyA3074184c.288T>C1.000
thyA3074187c.285A>G1.000
thyA3074199c.273C>T1.000
thyA3074205p.Glu89Asp1.000
thyA3074214c.258A>G1.000
thyA3074217c.255A>G1.000
thyA3074235c.237G>A1.000
thyA3074244c.228T>G1.000
thyA3074252p.Glu74Arg1.000
thyA3074263p.Gly70Asp1.000
thyA3074267p.Ile69Val1.000
thyA3074268c.204A>G1.000
thyA3074274c.198A>G1.000
thyA3074286c.186A>G1.000
thyA3074297c.175G>A1.000
thyA3074301c.171G>A1.000
thyA3074305p.Ala56Val1.000
thyA3074307c.165T>C1.000
thyA3074318p.Phe52Leu1.000
thyA3074322c.150G>C1.000
thyA3074325c.147T>C1.000
thyA3074334c.138A>G1.000
thyA3074339p.Leu45Ile1.000
thyA3074349c.123A>G1.000
thyA3074360c.112A>G0.985
thyA3074361c.111A>G1.000
thyA3074372p.Met34Leu1.000
thyA3074394c.78G>C1.000
thyA3074397c.75T>C1.000
ald3087257c.438T>C0.818
ald3087272c.453A>C0.857
ald3087278p.Gln153His0.857
ald3087281c.462G>C0.857
ald3087284c.465C>G0.857
ald3087290c.471T>C0.867
ald3087329c.510C>T0.318
ald3087339p.Ile174Val0.240
ald3087344c.525C>G0.240
ald3087347c.528C>G0.240
ald3087423p.Asp202Asn0.900
ald3087428c.609A>G0.900
ald3087436p.Gln206Leu0.900
ald3087557c.738A>C0.969
ald3087563p.Lys248Asn0.969
ald3087566c.747A>G1.000
ald3087567p.Val250Ile1.000
ald3087578c.759A>G1.000
ald3087590p.His257Gln1.000
ald3087596c.777A>G1.000
ald3087597p.Pro260Ser1.000
ald3087602c.783T>C1.000
ald3087608c.789A>G1.000
ald3087617c.798T>C0.967
ald3087620c.801A>C0.967
ald3087621p.Ala268Ser0.935
ald3087641c.822T>C0.919
ald3087647c.828A>G0.903
ald3087649p.Gly277Asp0.903
ald3087653c.834A>C0.897
ald3087656c.837A>G0.897
ald3087665c.846C>G0.897
ald3087666p.Tyr283His0.897
ald3087672p.His285Asp0.914
ald3087680c.861G>C0.919
ald3087699p.Leu294Val0.936
ald3087704c.885T>C0.940
ald3087726p.Ala303Ser0.930
ald3087729p.Ser304Ala0.930
ald3087737c.918G>C0.930
fbiA3640279c.-264T>G1.000
fbiA3640291c.-252T>C1.000
fbiA3640301c.-242GTTAAC>G1.000
fbiA3640302c.-241TTAACC>T1.000
fbiA3640307c.-236C>A1.000
fbiA3640347c.-196A>G1.000
fbiA3640349c.-194A>G1.000
fbiA3640350c.-193C>T1.000
fbiA3640365c.-178C>G1.000
fbiA3640433c.-110T>C1.000
fbiA3640442c.-101A>G1.000
fbiA3640445c.-98A>C1.000
fbiA3640453c.-90C>G1.000
fbiA3640457c.-86G>T1.000
fbiA3640562p.Ala7Val1.000
fbiA3640569c.27A>G1.000
fbiA3640572c.30C>T1.000
fbiA3640681p.Val47Ile1.000
fbiA3640689c.147C>T1.000
fbiA3640707c.165G>A1.000
fbiA3640713c.171T>C1.000
fbiA3640722c.180G>C1.000
fbiA3640726c.184C>T1.000
fbiA3640878c.336T>C1.000
fbiA3640899c.357G>C0.984
fbiA3640900p.Gln120Asn1.000
fbiA3640914c.372C>G1.000
fbiA3640918p.Ser126Thr1.000
fbiA3640931p.Glu130Ala1.000
fbiA3640935c.393C>G1.000
fbiA3640938c.396A>G1.000
fbiA3640944c.402T>C1.000
fbiA3640956c.414G>C1.000
fbiA3641073c.531T>C1.000
fbiA3641085c.543G>C1.000
fbiA3641088c.546G>C1.000
fbiA3641097c.555T>C1.000
fbiA3641100c.558T>G1.000
fbiA3641103c.561T>C1.000
fbiA3641112c.570T>C1.000
fbiA3641149p.Leu203Ile0.600
fbiA3641164p.Ile208Val0.600
fbiA3641274c.732G>C1.000
fbiA3641288p.Glu249Gly1.000
fbiA3641314p.Thr258Ala1.000
fbiA3641322c.780T>G1.000
fbiA3641328c.786T>G1.000
fbiA3641340p.Asp266Glu1.000
fbiA3641349c.807G>C1.000
fbiA3641351p.Ala270Glu1.000
fbiA3641355c.813T>C1.000
fbiA3641358c.816G>C1.000
fbiA3641364c.822G>C1.000
fbiA3641380p.Cys280Arg1.000
fbiA3641384p.Ala281Gly1.000
fbiA3641394c.852A>C1.000
fbiA3641400c.858C>T1.000
alr3840215c.1206A>G1.000
alr3840230c.1191A>C0.973
alr3840233c.1188T>C0.973
alr3840236c.1185T>G0.947
alr3840239c.1182C>G0.972
alr3840248c.1173G>C0.950
alr3840274p.Val383Leu0.974
alr3840275c.1146A>C0.974
alr3840287c.1134G>A0.950
alr3840293c.1128A>G0.946
alr3840296c.1125C>G0.939
alr3840302c.1119C>T0.935
alr3840310p.Arg371Asn0.933
alr3840312p.Ile370Ser0.935
alr3840328c.1093A>G0.977
alr3840329c.1092A>G0.977
alr3840344c.1077T>C0.976
alr3840353c.1068A>G0.966
alr3840357p.Leu355Pro1.000
alr3840382p.Met347Val1.000
alr3840404c.1017C>G0.962
alr3840407c.1014C>G0.958
alr3840410c.1011A>G0.958
alr3840413c.1008G>C0.958
alr3840418p.Cys335Arg0.958
alr3840419c.1002T>C0.958
alr3840424c.997T>C0.960
alr3840436p.Leu329Ser0.982
alr3840442p.Glu327Gln0.985
alr3840469p.Val318Ile0.983
alr3840476c.945T>G0.982
alr3840482c.939A>G0.981
alr3840487p.Ile312Val0.981
alr3840503c.918A>G1.000
alr3840516p.Pro302Gln1.000
alr3840522p.Ile300Thr1.000
alr3840527c.894T>G1.000
alr3840533c.888C>T1.000
alr3840536c.885A>G1.000
alr3840539c.882C>T1.000
alr3840547p.Gly292Ser1.000
alr3840548c.873C>T1.000
alr3840560c.861A>T1.000
alr3840566c.855T>C1.000
alr3840575c.846C>T1.000
alr3840578c.843A>C1.000
alr3840583p.Ala280Thr1.000
alr3840593c.828G>C1.000
alr3840602c.819C>G1.000
alr3840611c.810C>G1.000
alr3840620c.801A>G1.000
alr3840623c.798G>C1.000
alr3840627p.Ala265Glu1.000
alr3840632c.789T>G0.933
alr3840635c.786C>A0.933
alr3840641c.780T>G0.933
alr3840644c.777C>G0.933
alr3840647c.774A>G0.933
alr3840659c.762G>A0.962
alr3840665c.756C>G0.962
alr3840673p.Leu250Met0.962
alr3840682p.Thr247Ala0.962
alr3840926c.495A>G1.000
alr3840944c.477A>G1.000
alr3840947c.474C>G1.000
alr3840959c.462C>G1.000
alr3840965c.456C>G1.000
alr3840968c.453C>G1.000
alr3840982p.Arg147Asp1.000
alr3840994p.His143Ala1.000
alr3840997c.424A>G1.000
alr3841001c.420T>C1.000
alr3841010c.411T>C1.000
alr3841017p.Leu135Gln1.000
alr3841027p.Val132Leu1.000
alr3841029p.Ala131Gly1.000
alr3841033p.Val130Ile1.000
alr3841041p.Asp127Gly1.000
alr3841060p.Gly121Arg1.000
alr3841100c.321T>C1.000
alr3841104p.Thr106Ser1.000
alr3841106c.315A>G1.000
alr3841109c.312G>C1.000
alr3841113p.Asp103Ala1.000
alr3841115c.306A>G1.000
alr3841127c.294T>C1.000
alr3841148c.273G>C1.000
alr3841208c.213A>G1.000
alr3841232c.189C>G1.000
alr3841240p.Leu61Val1.000
alr3841249p.His58Gly1.000
alr3841252p.Gly57Arg1.000
alr3841256p.His55Gln1.000
alr3841264p.Arg53Cys1.000
alr3841270p.Val51Leu1.000
alr3841283c.138T>C1.000
alr3841286c.135A>G1.000
alr3841289c.132A>G1.000
alr3841298c.123A>G1.000
alr3841301c.120C>G1.000
alr3841306p.Met39Leu1.000
alr3841307c.114G>C1.000
panD4043913c.369A>G1.000
panD4043933p.Met117Leu1.000
panD4043939p.Ile115Val1.000
panD4043943c.339T>C1.000
panD4043951p.Tyr111Asp1.000
panD4043952c.330A>G1.000
panD4043961c.321A>G1.000
panD4043964c.318C>G1.000
panD4044057c.225G>T0.967
panD4044072c.210G>C0.969
panD4044075c.207A>G0.969
panD4044081c.201A>C0.970
panD4044084c.198A>G0.970
panD4044090c.192G>A0.971
panD4044093c.189T>C0.971
panD4044096c.186G>A0.971
panD4044120c.162T>C1.000
panD4044123c.159A>G1.000
panD4044126c.156A>G1.000
panD4044138c.144A>G1.000
panD4044150c.132T>C1.000
panD4044162c.120T>C1.000
panD4044165c.117C>G1.000
panD4044188c.94A>G1.000
panD4044195c.87A>G1.000
panD4044213c.69G>C1.000
panD4044237c.45C>G1.000
panD4044240c.42C>G1.000
panD4044246c.36G>C1.000
panD4044249c.33G>A1.000
panD4044264c.18C>G1.000
embC4240006c.144A>G1.000
embC4240010c.148C>T1.000
embC4240019p.Asn53Asp1.000
embC4240033c.171G>C1.000
embC4240036c.174A>G1.000
embC4240037c.175T>C1.000
embC4240059p.Thr66Ser1.000
embC4240065p.Ala68Gly1.000
embC4240069c.207T>C1.000
embC4240072c.210C>G1.000
embC4240078c.216A>G1.000
embC4240087c.225T>C1.000
embC4240090c.228C>T1.000
embC4240105c.243C>T1.000
embC4240123c.261C>G1.000
embC4240141c.279A>G1.000
embC424015598QNTGKTVLLSTVPKQAPKAVDRGLLLQRANDDLVLVVRNVPLVTAPLSQVLGPTCQRLTFTAHADRVAAEFVGLVQGPNAEHPGAPLRGERSGYDFRPQIVGVFTDLAGPAPPGLSFSASVDTRYSSSPTPLKMAAMILGVALTGAALVALHILDTADGMRHRRFLPARWWSTGGLDTLVIAVLVWWHFVGANTSDDGYILTMARVSEHAGYMANYYRWFGTPEAPFGWYYDLLALWAHVSTASIWMRLPTLAMALTCWWVISREVIPRLGHAVKTSRAAAWTAAGMFLAVWLPLDNGLRPEPIIALGILLTWCSVERAVATSRLLPVAIACIIGALTLFSGPTGIASIGALLVAIGPLRTILHRRSRRFGVLPLVAPILAAATVTAIPIFRDQTFAGEIQANLLKRAVGPSLKWFDEHIRYERLFMASPDGSIARRFAVLALVLALAVSVAMSLRKGRIPGTAAGPSRRIIGITIISFLAMMFTPTKWTHHFGVFAGLAGSLGALAAVAVTGAAMRSRRNRTVFAAVVVFV>98PGQPRQDGVVVDGAQAGAQGGRPRAADRAGQRRPGAGGAQRPGGDGPAEPGAGPGLPAVDLHRARRSGRRRIRRTGAGTQC*1.000
embC4241695r.1833t>g1.000
embC4241746r.1884c>t1.000
embC4241747r.1885g>t1.000
embC4241750p.Leu630Val1.000
embC4241755c.1893C>A1.000
embC4241770c.1908T>C1.000
embC4241791c.1929G>C1.000
embC4241794c.1932C>G1.000
embC4241797c.1935C>T0.978
embC4241803c.1941T>G0.978
embC4241809c.1947A>G0.978
embC4241869c.2007G>C0.950
embC4241887c.2025A>G0.960
embC4241893c.2031A>C0.960
embC4241902c.2040C>T0.955
embC4242106c.2244C>G1.000
embC4242112c.2250G>C1.000
embC4242121c.2259A>G1.000
embC4242220c.2358A>C1.000
embC4242221p.Pro787Ala1.000
embC4242229c.2367C>G1.000
embC4242244c.2382C>G1.000
embC4242245p.Thr795Arg1.000
embC4242391c.2529G>C1.000
embC4242400c.2538C>G1.000
embC4242403c.2541T>C1.000
embC4242406c.2544A>G1.000
embC4242427c.2565A>C1.000
embC4242428p.Ala856Ser1.000
embC4242434p.Val858Ile1.000
embC4242449p.Met863His1.000
embC4242460c.2598G>C1.000
embC4242517c.2655G>C1.000
embC4242519p.Thr886Ser1.000
embC4242532c.2670A>T1.000
embC4242539p.Ser893Pro1.000
embC4242552p.Arg897Gln1.000
embC4242554p.Leu898Val1.000
embC4242577c.2715A>G0.974
embC4242585p.Ala908Gly0.952
embC4242589c.2727A>G0.952
embC4242594p.His911Pro0.952
embC4242598c.2736T>C0.952
embC4242601c.2739G>C0.952
embC4242605p.Met915Phe0.952
embC4242608p.Glu916Gln0.909
embC4242625c.2763T>C0.906
embC4242628c.2766C>G0.906
embC4242629p.Ala923Ser0.906
embC4242652c.2790C>G0.929
embC4242653p.Ala931Leu0.929
embC4242658c.2796A>G0.929
embC4242664c.2802C>G0.929
embC4242667c.2805C>G0.929
embC4242674p.Ser938Ala0.929
embC4242677p.Thr939Ala0.929
embC4242710p.Gln950Glu0.980
embC4242715c.2853T>C0.979
embC4242721c.2859G>C1.000
embC4242730c.2868C>T1.000
embC4242736c.2874C>T1.000
embC4242739c.2877C>G1.000
embC4242742c.2880C>G1.000
embC4242745c.2883A>G1.000
embC4242748c.2886A>G1.000
embC4242754c.2892G>T1.000
embC4242760c.2898G>C1.000
embC4242762p.Arg967Gln1.000
embC4242764p.Val968Leu1.000
embC4242772c.2910G>C1.000
embC4242779p.Asn973Asp1.000
embC4242792p.Ala977Glu1.000
embC4242799c.2937T>C1.000
embC4242823c.2961G>C1.000
embC4242826c.2964G>C1.000
embC4242832c.2970A>C1.000
embC4242844c.2982A>G1.000
embC4242847c.2985C>G1.000
embC4242859c.2997C>T1.000
embC4242862c.3000A>G1.000
embC4242863p.Tyr1001Asn1.000
embC4242871c.3009C>G1.000
embC4242880c.3018A>G1.000
embC4242883c.3021C>G1.000
embC4242886c.3024G>A1.000
embC4242892c.3030G>C1.000
embC4242907c.3045G>A1.000
embC4242919c.3057A>G1.000
embC4242928c.3066A>G1.000
embC4242940c.3078T>C1.000
embC4242941p.His1027Asn1.000
embC4242946c.3084T>C1.000
embC4242952c.3090T>C1.000
embC4242965p.Ile1035Val1.000
embA4243218c.-15C>T1.000
embA4243222c.-11C>G1.000
embA4243412c.180C>G1.000
embA4243415c.183T>C1.000
embA4243421c.189A>G1.000
embA4243424c.192C>G1.000
embA4243433c.201A>C1.000
embA4243451c.219G>C1.000
embA4243461p.Ser77Pro0.889
embA4243467p.Ile79Val0.895
embA4243475c.243G>C0.889
embA4243485p.Asn85Asp1.000
embA4243736c.504A>C1.000
embA4243742c.510T>C1.000
embA4243748c.516C>G1.000
embA4243763c.531G>C1.000
embA4243781c.549C>G1.000
embA4243787c.555G>T1.000
embA4243811c.579T>C1.000
embA4243817c.585T>C1.000
embA4244070p.Val280Ile1.000
embA4244084c.852C>G1.000
embA4244189c.957C>G1.000
embA4244198c.966C>G1.000
embA4244207c.975C>G1.000
embA4244216c.984C>G1.000
embA4244219c.987C>G1.000
embA4244228c.996A>G1.000
embA4244233p.Ala334Gly1.000
embA4244247p.Val339Ile1.000
embA4244254p.Arg341His1.000
embA4244257p.Phe342Trp1.000
embA4244267c.1035G>C1.000
embA4244276c.1044A>C1.000
embA4244284p.Pro351Arg1.000
embA4244298p.Ser356Ala1.000
embA4244309c.1077C>G1.000
embA4244312c.1080T>G1.000
embA4244315c.1083G>C1.000
embA4244324c.1092T>G1.000
embA4244327c.1095T>C1.000
embA4244337p.Leu369Val1.000
embA4244340p.Ser370Ala1.000
embA4244366c.1134C>G1.000
embA4244372c.1140T>G1.000
embA4244378c.1146G>A1.000
embA4244396c.1164T>C1.000
embA4244408c.1176G>C1.000
embA4244412p.Val394Met1.000
embA4244415c.1183T>C0.973
embA4244427p.Ser399Ala1.000
embA4244567c.1335C>G0.844
embA4244576c.1344G>C0.844
embA4244578p.Thr449Ser0.844
embA4244582c.1350T>C0.974
embA4244585c.1353A>T0.925
embA4244612c.1380C>G0.873
embA4244619c.1387T>C0.984
embA4244631p.Thr467Leu0.938
embA4244645c.1413T>C0.923
embA4244648c.1416G>C0.923
embA4244649p.Asp473Ser0.923
embA4244657c.1425G>C0.923
embA4244658p.Leu476Val0.923
embA4244670p.Ala480Leu1.000
embA4244675c.1443A>G1.000
embA4244681c.1449A>C1.000
embA4244684c.1452C>G1.000
embA4244690c.1458G>A1.000
embA4244708c.1476C>G0.983
embA4244726c.1494C>T0.978
embA4244728p.Phe499Trp0.978
embA4244730c.1498C>T0.978
embA4244885c.1653A>G1.000
embA4244897c.1665T>C0.986
embA4244900c.1668G>C0.986
embA4244903c.1671G>C0.986
embA4244919c.1687C>T0.976
embA4244933c.1701A>G0.978
embA4244945c.1713C>G0.966
embA4244948c.1716G>C0.966
embA4244960c.1728A>C0.922
embA4244980p.Val583Ala0.900
embA4244982c.1750T>C0.895
embA4244987c.1755T>C0.889
embA4244991p.Val587Leu0.882
embA4245003p.Thr591Ala0.857
embA4245011c.1779C>T0.846
embA4245020c.1788T>C0.917
embA4245023c.1791A>G0.917
embA4245026c.1794T>C0.917
embA4245028p.Ser599Asn0.917
embA4245032c.1800A>C0.944
embA4245038c.1806C>T0.986
embA4245056c.1824C>G0.959
embA4245077c.1845G>C0.962
embA4245083c.1851A>C0.960
embA4245089c.1857G>C0.925
embA4245092c.1860C>G0.971
embA4245101c.1869G>C0.973
embA4245137c.1905T>C0.973
embA4245149c.1917C>G0.972
embA4245182c.1950T>C0.963
embA4245194c.1962G>C0.967
embA4245198p.Leu656Ile0.949
embA4245206c.1974A>G0.972
embA4245207c.1975T>C0.972
embA4245215c.1983A>G0.964
embA4245222p.Tyr664Gln0.975
embA4245242c.2010C>T0.971
embA4245245c.2013C>G0.955
embA4245248c.2016G>C0.969
embA4245257c.2025A>G0.982
embA4245263c.2031A>G1.000
embA4245268p.Asn679Ser1.000
embA4245355p.Ala708Gly1.000
embA4245368c.2136T>C1.000
embA4245377c.2145T>G1.000
embA4245388p.Ala719Gly1.000
embA4245402p.Thr724Ala1.000
embA4245407c.2175G>C0.818
embA4245408p.Leu726Ile0.818
embA4245411p.Ser727Gly0.818
embA4245431c.2199T>C1.000
embA4245461c.2229C>G1.000
embA4245465p.Pro745Ala0.980
embA4245470c.2238T>C1.000
embA4245485c.2253A>G1.000
embA4245489p.Val753Leu1.000
embA4245501p.Ala757Thr1.000
embA4245509c.2277A>G1.000
embA4245518c.2286A>G1.000
embA4245524c.2292G>C1.000
embA4245530c.2298T>G1.000
embA4245531p.Ile767Val1.000
embA4245535p.Ser768Asn1.000
embA4245539c.2307C>G1.000
embA4245557p.Glu775Asp1.000
embA4245569p.Glu779Asp1.000
embA4245575c.2343C>G1.000
embA4245576p.Lys782Gln1.000
embA4245587c.2355G>C1.000
embA4245593c.2361C>G1.000
embA4245594p.Ser788Thr1.000
embA4245599c.2367A>G1.000
embA4245617c.2385C>G1.000
embA4245620c.2388T>C1.000
embA4245623c.2391G>C1.000
embA4245626c.2394G>C1.000
embA4245643p.Ala804Val1.000
embA4245648p.Ile806Tyr1.000
embA4245652p.Thr807Ser1.000
embA4245659c.2427C>G1.000
embA4245674c.2442A>C1.000
embA4245677c.2445G>C1.000
embA4245683c.2451C>G1.000
embA4245689c.2457C>G1.000
embA4245692c.2460G>C1.000
embA4245693p.Ile821Val1.000
embA4245701c.2469G>C1.000
embA4245716c.2484G>C1.000
embA4245725c.2493A>C1.000
embA4245726c.2494T>C1.000
embA4245737c.2505A>C1.000
embA4245740c.2508T>C1.000
embA4245764c.2532G>C1.000
embA4245771p.Asn847Ser1.000
embA4245807c.2575T>C1.000
embA4245820p.Ser863Thr0.880
embA4245830c.2598G>C0.896
embA4245845c.2613T>G1.000
embA4245848c.2616C>G1.000
embA4245860c.2628C>G1.000
embA4245885p.Asp885Thr1.000
embA4245892p.Ile887Thr1.000
embA4245905c.2673C>G1.000
embA4245926c.2694C>G1.000
embA4245927p.Thr899Ala1.000
embA4245930p.Gly900Arg1.000
embA4245983c.2751A>C1.000
embA4245989c.2757A>G0.984
embA4245992c.2760C>G1.000
embA4246010c.2778G>C1.000
embA4246013c.2781T>C1.000
embA4246041p.Asp937Asn1.000
embA4246055c.2823T>C1.000
embA4246064c.2832T>C1.000
embA4246079c.2847C>T1.000
embA4246080p.Pro950Ser1.000
embA4246088c.2856A>G1.000
embA4246097c.2865C>G1.000
embA4246109c.2877C>G1.000
embA4246115c.2883T>G1.000
embA4246164p.Leu978Met1.000
embA4246184c.2952A>G1.000
embA4246187c.2955C>G1.000
embA4246196c.2964C>G1.000
embA4246250c.3018G>C1.000
embA4246264p.His1011Arg1.000
embA4246274c.3042G>C1.000
embA4246292c.3060A>G1.000
embA42463031024SST>1024SEA0.951
embA4246316c.3084T>G1.000
embA4246329p.Thr1033Leu1.000
embA4246355c.3123G>C1.000
embA4246359p.Ala1043Pro1.000
embA4246364c.3132G>C1.000
embA4246367c.3135C>T1.000
embA4246373c.3141T>C1.000
embA4246376c.3144G>C1.000
embA4246413p.His1061Phe1.000
embA4246419c.3187C>T1.000
embA4246439c.3207T>G1.000
embA4246442c.3210A>G1.000
embB4246603c.90C>G1.000
embB4246621c.108T>C1.000
embB4246624c.111C>G1.000
embB4246627c.114T>C1.000
embB4246631c.118T>C1.000
embB4246639c.126G>C1.000
embB4246642c.129G>C1.000
embB4246645c.132G>C0.968
embB4246882c.369G>C1.000
embB4246961p.Val150Ile1.000
embB4246964p.Thr151Ala1.000
embB4246969c.456T>G1.000
embB4246974p.His154Arg1.000
embB4246992p.Asn160Thr1.000
embB4247119c.606C>G1.000
embB4247140c.627G>A1.000
embB4247317c.804G>C1.000
embB4247326c.813A>G1.000
embB4247328p.Ser272Asn1.000
embB4247338c.825C>G1.000
embB4247348p.Thr279Ala1.000
embB4247355p.Ala281Val1.000
embB4247358p.Val282Ala1.000
embB4247365c.852A>C1.000
embB4247371c.858C>G1.000
embB4247375p.Leu288Val1.000
embB4247386c.873T>C1.000
embB4247389c.876C>G1.000
embB4247395c.882C>G0.984
embB4247401c.888T>C1.000
embB4247437c.924A>G1.000
embB4247440c.927C>G1.000
embB4247464c.951C>G1.000
embB4247470c.957T>C1.000
embB4247491c.978G>C1.000
embB4247500c.987C>G1.000
embB4247512c.999T>C1.000
embB4247536c.1023C>G1.000
embB4247554c.1041T>C1.000
embB4247566c.1053C>G1.000
embB4247567c.1054C>T1.000
embB4247572c.1059A>G0.984
embB4247579p.Ala356Phe1.000
embB4247587c.1074G>A1.000
embB4247603c.1090C>T1.000
embB4247611c.1098G>C1.000
embB4247614c.1101T>C1.000
embB4247629c.1116C>G1.000
embB4247632c.1119C>G1.000
embB4247635c.1122G>A1.000
embB4247646p.Glu378Ala1.000
embB4247655p.Lys381Arg1.000
embB4247659c.1146C>G1.000
embB4247683c.1170C>G1.000
embB4247692c.1179C>G1.000
embB4247716c.1203C>G1.000
embB4247722c.1209G>C1.000
embB4247725c.1212G>C1.000
embB4247729p.Gly406Pro1.000
embB4247743c.1230C>G1.000
embB4247746c.1233C>A1.000
embB4247776c.1263G>T1.000
embB4247779c.1266C>G1.000
embB4247785c.1272G>C1.000
embB4247800c.1287A>C1.000
embB4247806c.1293G>C0.979
embB4247819p.Val436Ile1.000
embB4247824c.1311C>G1.000
embB4247830c.1317A>C1.000
embB4247836c.1323A>G1.000
embB4247842c.1329T>C1.000
embB4247876c.1363C>T0.800
embB4247881c.1368G>C0.852
embB4247887c.1374C>T0.913
embB4247890c.1377C>T1.000
embB4247899p.Met462Ile1.000
embB4247951p.Ser480Ala1.000
embB4247956c.1443G>C0.900
embB4247974c.1461C>G1.000
embB4247977c.1464C>G1.000
embB4247986c.1473C>G1.000
embB4248007c.1494C>G1.000
embB4248011p.Ser500Ala1.000
embB4248035p.Val508Ile1.000
embB4248041p.Ala510Thr1.000
embB4248044p.Lys511Ala1.000
embB4248052c.1539G>A1.000
embB4248055c.1542G>C1.000
embB4248064c.1551G>C1.000
embB4248070c.1557T>C1.000
embB4248085c.1572T>C1.000
embB4248095c.1582C>T0.976
embB4248118c.1605T>C0.979
embB4248127c.1614G>C0.981
embB4248133c.1620C>G0.982
embB4248142c.1629T>C0.982
embB4248143c.1630T>C0.982
embB4248157c.1644A>G0.987
embB4248206p.Ser565Gly1.000
embB4248220c.1707A>G1.000
embB4248241c.1728C>T1.000
embB4248265c.1752C>T1.000
embB4248266c.1753C>T1.000
embB4248277c.1764G>C1.000
embB4248298c.1785C>T1.000
embB4248304c.1791G>C1.000
embB4248316c.1803C>G1.000
embB4248319c.1806A>G1.000
embB4248343c.1830G>C1.000
embB4248346c.1833G>C1.000
embB4248350c.1837T>C1.000
embB4248355c.1842A>G1.000
embB4248358c.1845C>G1.000
embB4248361c.1848A>G1.000
embB4248362p.Ser617Ala0.986
embB4248398c.1885C>T1.000
embB4248403c.1890G>C1.000
embB4248407c.1894T>C1.000
embB4248410p.Phe633Leu1.000
embB4248416p.Leu635Met1.000
embB4248419p.Leu636Met1.000
embB4248425c.1912T>C1.000
embB4248430c.1917T>C1.000
embB4248432p.Trp640Phe1.000
embB4248460c.1947C>G1.000
embB4248472c.1959T>G1.000
embB4248504p.Asp664Gly1.000
embB4248508c.1995G>A1.000
embB4248514c.2001A>G1.000
embB4248524p.Ile671Val1.000
embB4248649c.2136T>C1.000
embB4248659p.Ala716Leu1.000
embB4248668p.Val719Ile1.000
embB4248676c.2163C>G1.000
embB4248688c.2175G>C1.000
embB4248694c.2181G>C1.000
embB4248697c.2184A>C1.000
embB4248706c.2193G>C1.000
embB4248720p.Gly736Ala1.000
embB4248725p.Ser738Asp1.000
embB4248731p.Val740Leu1.000
embB4248736c.2223G>C1.000
embB4248738p.Ala742Glu1.000
embB4248742c.2229T>C1.000
embB4248743p.Val744Ser1.000
embB4248772c.2259A>G1.000
embB4248961c.2448T>C1.000
embB4249138c.2625C>G1.000
embB4249153c.2640G>T1.000
embB4249255c.2742G>C1.000
embB4249259p.Met916Leu1.000
embB4249268p.Asp919Tyr1.000
embB4249276c.2763A>G1.000
embB4249282c.2769A>C1.000
embB4249297c.2784G>C1.000
embB4249321c.2808A>C1.000
embB4249322p.Ala937Ser1.000
embB4249325p.Lys938Asp1.000
embB4249336c.2823C>G1.000
embB4249339c.2826T>C1.000
embB4249340p.Ala943Thr1.000
embB4249345c.2832C>G1.000
embB4249348c.2835G>C1.000
embB4249351c.2838C>G1.000
embB4249369c.2856T>C1.000
embB4249381c.2868A>G1.000
embB4249417c.2904A>G1.000
embB4249420c.2907G>C1.000
embB4249423p.Asp970Glu1.000
embB4249424p.Leu971Met1.000
embB4249432c.2919A>G1.000
embB4249441c.2928A>G1.000
embB4249444c.2931T>C1.000
embB4249447c.2934G>C1.000
embB4249456c.2943G>C1.000
embB4249469p.Leu986Met1.000
embB4249483c.2970C>G1.000
embB4249486c.2973T>G1.000
embB4249487c.2974T>C1.000
embB4249498c.2985G>C0.983
embB4249521p.Ala1003Val0.974
embB4249525c.3012T>C0.974
embB4249528c.3015C>G0.972
embB4249529p.Ile1006Val0.972
embB4249532p.Ala1007Thr0.972
embB4249537c.3024A>G0.972
embB4249543c.3030G>C0.977
embB4249558c.3045A>C0.950
embB4249564c.3051C>T0.944
embB4249568p.Ser1019Thr0.941
embB4249573c.3060T>C0.939
embB4249580p.Leu1023Met0.947
embB4249594c.3081G>C0.950
embB4249600c.3087A>G0.949
embB4249609c.3096T>C0.943
embB4249615c.3102C>G0.943
embB4249624c.3111C>G0.941
embB4249640c.3127T>C0.926
embB4249651c.3138C>G0.950
ethA4326057p.Ile473Val1.000
ethA4326059p.Lys472Arg1.000
ethA4326304c.1170G>C1.000
ethA4326307c.1167G>T1.000
ethA4326310c.1164A>G1.000
ethA4326438p.Leu346Met1.000
ethA4326445c.1029C>T1.000
ethA4326459p.Ile339Val1.000
ethA4326469c.1005A>G1.000
ethA4326498c.976G>T1.000
ethA4326502c.972T>G1.000
ethA4326510p.Ala322Thr1.000
ethA4326520p.Glu318Asp1.000
ethA4326523c.951A>G1.000
ethA4326620p.His285Arg1.000
ethA4326625c.849G>C1.000
ethA4326639p.Arg279Glu1.000
ethA4326649c.825C>G1.000
ethA4326847c.627G>C1.000
ethA4326850c.624T>C1.000
ethA4326985c.489A>G1.000
ethA4326990p.Ile162Val1.000
ethA4326996p.Pro160Thr1.000
ethA4326997c.477C>G1.000
ethA4327001p.Val158Gly1.000
ethA4327014p.Ser154Ala1.000
ethA4327015c.459G>C1.000
ethA4327020p.Ala152Pro1.000
ethA4327025p.Arg150Thr1.000
ethA4327027c.447C>G1.000
ethA4327390c.84C>G1.000
ethA4327396c.78A>G1.000
ethA4327401p.Asp25Asn1.000
ethA4327417c.57C>G1.000
ethA4327420c.54G>A1.000
ethA4327423c.51G>C1.000
ethA4327426c.48A>G1.000
ethA4327438c.36A>G1.000
gid4407603c.600C>T1.000
gid4407609c.594C>G1.000
gid4407652p.Val184Ala1.000
gid4407654c.549C>G1.000
gid4407667p.Ile179Thr1.000
gid4407756c.447G>A1.000
gid4407762c.441T>C1.000
gid4407770c.433A>G1.000
gid4407783c.420G>T1.000
gid4407786c.417C>A1.000
gid4407792c.411C>T1.000
gid4407795c.408T>C1.000
gid4407804c.399A>C1.000

Analysis pipeline specifications

TBProfiler Version: 2.1.1

AnalysisProgram
Mappingbwa
Variant CallingBCFtools


Log

Drug Details
The estimated accuracy of drug resistance predictions is:

Drug1Sensitivity (%)Specificity (%)
Isoniazid 92.8 (89.9-95.7)100 (100-100)
Rifampicin 96.2 (93.9-98.5)98.1 (96.8-99.4)
Ethambutal 88.7 (83.6-93.8)81.7 (77.6-85.8)
Pyrazinamide70.9 (62.4-79.4)93.9 (90.6-97.2)
Streptomycin87.1 (82.7-91.5)89.7 (86.0-93.4)
Ethionamide 73.6 (66.7-80.5)93.3 (89.6-97.0)
Moxifloxacin60.0 (29.6-90.4)68.7 (52.6-84.8)
Ofloxacin 85.5 (79.1-91.9)94.9 (91.8-98.0)
Amikacin 82.9 (74.4-91.4)98.3 (96.0-100)
Capreomycin 60.7 (50.6-70.8)90.7 (87.2-94.2)
Kanamycin 87.3 (81.3-93.3)93.4 (89.9-96.9)
Para-aminosalisylic acidNot determinedNot determined
Linezolid Not determinedNot determined
Clofazimine Not determinedNot determined
Bedaquiline Not determinedNot determined
Multi drug resistance91.2 (87.8-94.6)98.4 (97.2-99.6)
Extremely drug resistance75.9 (64.5-87.3)98.4 (97.3-99.5)

Lineages
Lineage2LocationStrainRD type
lineage1Indo-OceanicEAIRD239
lineage1.1Indo-OceanicEAI3;EAI4;EAI5;EAI6RD239
lineage1.1.1Indo-OceanicEAI4;EAI5RD239
lineage1.1.1.1Indo-OceanicEAI4;ZERORD239
lineage1.1.2Indo-OceanicEAI3;EAI5RD239
lineage1.1.3Indo-OceanicEAI6RD239
lineage1.2Indo-OceanicEAI1;EAI2RD239
lineage1.2.1Indo-OceanicEAI2RD239
lineage1.2.2Indo-OceanicEAI1RD239
lineage2East-AsianBeijingRD105
lineage2.1East-Asian (non-Beijing)NoneNone
lineage2.2East-Asian (Beijing)Beijing-RD207RD105;RD207
lineage2.2.2East-Asian (Beijing)Beijing-RD105/RD207RD105;RD207
lineage2.2.1East-Asian (Beijing)Beijing-RD181RD105;RD207;RD181
lineage2.2.1.2East-Asian (Beijing)Beijing-RD142RD105;RD207;RD181;RD142
lineage2.2.1.1East-Asian (Beijing)Beijing-RD150RD105;RD207;RD181;RD150
lineage3East-African-IndianCASRD750
lineage3.1East-African-IndianNon-CAS1-DelhiRD750
lineage3.1.1East-African-IndianCAS1-KiliRD750
lineage3.1.2East-African-IndianCAS;CAS2RD750
lineage3.1.2.1East-African-IndianCAS2RD750
lineage3.1.2.2East-African-IndianCASRD750
lineage4Euro-AmericanLAM;T;S;X;HNone
lineage4.1Euro-AmericanT;X;HNone
lineage4.1.2Euro-American (X-type)T;HNone
lineage4.1.2.1Euro-American (X-type)T1;H1RD182
lineage4.1.1Euro-American (X-type)X1;X2;X3None
lineage4.1.1.2Euro-American (X-type)X1None
lineage4.1.1.1Euro-American (X-type)X2RD183
lineage4.1.1.3Euro-American (Haarlem)X1;X3RD193
lineage4.2Euro-AmericanH;T;LAMNone
lineage4.2.2Euro-American (Ural)T;LAM7-TURNone
lineage4.2.2.1Euro-AmericanLAM7-TURNone
lineage4.2.1Euro-American (TUR)H3;H4None
lineage4.3Euro-American (LAM)mainly-LAMNone
lineage4.3.1Euro-American (LAM)LAM9None
lineage4.3.3Euro-American (LAM)LAM;TRD115
lineage4.3.4Euro-American (LAM)LAMRD174
lineage4.3.4.1Euro-American (LAM)LAM1;LAM2RD174
lineage4.3.4.2Euro-American (LAM)LAM1;LAM4;LAM11RD174
lineage4.3.4.2.1Euro-American (LAM)LAM11RD174
lineage4.3.2Euro-American (LAM)LAM3None
lineage4.3.2.1Euro-American (LAM)LAM3RD761
lineage4.4Euro-AmericanS;TNone
lineage4.4.2Euro-AmericanT1;T2None
lineage4.4.1Euro-American (S-type)S;TNone
lineage4.4.1.2Euro-AmericanT1None
lineage4.4.1.1Euro-AmericanS;OrphansNone
lineage4.5Euro-AmericanH;TRD122
lineage4.6Euro-AmericanT;LAMNone
lineage4.6.1Euro-American (Uganda)T2RD724
lineage4.6.1.1Euro-American T2-UgandaRD724
lineage4.6.1.2Euro-AmericanT2RD724
lineage4.6.2Euro-AmericanT;LAMRD726
lineage4.6.2.1Euro-AmericanT3RD726
lineage4.6.2.2Euro-American (Cameroon)LAM10-CAMRD726
lineage4.7Euro-American (mainly T)T1;T5None
lineage4.8Euro-American (mainly T)T1;T2;T3;T5RD219
lineage4.9Euro-American (H37Rv-like)T1None
lineage5West-Africa 1AFRI_2;AFRI_3RD711
lineage6West-Africa 2AFRI_1RD702
lineage7Lineage 7NoneNone
lineageBOVM. bovisBOV_1;BOV_2None

Citations
1. Coll F, et al. Rapid determination of anti-tuberculosis drug resistance from whole genome sequences. Genome Medicine (in press)
2. Coll F, et al. A robust SNP barcode for typing Mycobacterium tuberculosis complex strains. Nature Communications 2014.

Disclaimer
This tool is for Research Use Only and is offered free for use. The London School of Hygiene and Tropical Medicine shall have no liability for any loss or damages of any kind, however sustained relating to the use of this tool.
© 2019 London School of Hygiene and Tropical Medicine;